Recombinant Full Length Human MIXL1 Protein, GST-tagged
Cat.No. : | MIXL1-6273HF |
Product Overview : | Human MIXL1 full-length ORF ( ADR83322.1, 1 a.a. - 232 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 232 amino acids |
Description : | Homeodomain proteins, such as MIXL1, are transcription factors that regulate cell fate during development (Hart et al., 2005 [PubMed 15982639]).[supplied by OMIM |
Molecular Mass : | 25.6 kDa |
AA Sequence : | MATAESRALQFAEGAAFPAYRAPHAGGALLPPPSPAAALLPAPPAGPGPATFAGFLGRDPGPAPPPPASLGSPAPPKGAAAPSASQRRKRTSFSAEQLQLLELVFRRTRYPDIHLRERLAALTLLPESRIQVWFQNRRAKSRRQSGKSFQPLARPEIILNHCAPGTETKCLKPQLPLEVDVNCLPEPNGVGGGISDSSSQGQNFETCSPLSEDIGSKLDSWEEHIFSAFGNF |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MIXL1 Mix paired-like homeobox [ Homo sapiens ] |
Official Symbol | MIXL1 |
Synonyms | MIXL1; Mix paired-like homeobox; Mix1 homeobox (Xenopus laevis) like 1 , Mix1 homeobox like 1 (Xenopus laevis); homeobox protein MIXL1; MILD1; MIXL; hMix; homeodomain protein MIX; Mix-like homeobox protein 1; mix.1 homeobox-like protein; MIX1 homeobox-like protein 1; MIX; MGC138179; |
Gene ID | 83881 |
mRNA Refseq | NM_031944 |
Protein Refseq | NP_114150 |
MIM | 609852 |
UniProt ID | Q9H2W2 |
◆ Recombinant Proteins | ||
MIXL1-6273HF | Recombinant Full Length Human MIXL1 Protein, GST-tagged | +Inquiry |
MIXL1-6548C | Recombinant Chicken MIXL1 | +Inquiry |
MIXL1-5357H | Recombinant Human MIXL1 Protein, GST-tagged | +Inquiry |
MIXL1-9858M | Recombinant Mouse MIXL1 Protein | +Inquiry |
MIXL1-5570M | Recombinant Mouse MIXL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MIXL1 Products
Required fields are marked with *
My Review for All MIXL1 Products
Required fields are marked with *