Recombinant Full Length Human MIXL1 Protein, GST-tagged

Cat.No. : MIXL1-6273HF
Product Overview : Human MIXL1 full-length ORF ( ADR83322.1, 1 a.a. - 232 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 232 amino acids
Description : Homeodomain proteins, such as MIXL1, are transcription factors that regulate cell fate during development (Hart et al., 2005 [PubMed 15982639]).[supplied by OMIM
Molecular Mass : 25.6 kDa
AA Sequence : MATAESRALQFAEGAAFPAYRAPHAGGALLPPPSPAAALLPAPPAGPGPATFAGFLGRDPGPAPPPPASLGSPAPPKGAAAPSASQRRKRTSFSAEQLQLLELVFRRTRYPDIHLRERLAALTLLPESRIQVWFQNRRAKSRRQSGKSFQPLARPEIILNHCAPGTETKCLKPQLPLEVDVNCLPEPNGVGGGISDSSSQGQNFETCSPLSEDIGSKLDSWEEHIFSAFGNF
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MIXL1 Mix paired-like homeobox [ Homo sapiens ]
Official Symbol MIXL1
Synonyms MIXL1; Mix paired-like homeobox; Mix1 homeobox (Xenopus laevis) like 1 , Mix1 homeobox like 1 (Xenopus laevis); homeobox protein MIXL1; MILD1; MIXL; hMix; homeodomain protein MIX; Mix-like homeobox protein 1; mix.1 homeobox-like protein; MIX1 homeobox-like protein 1; MIX; MGC138179;
Gene ID 83881
mRNA Refseq NM_031944
Protein Refseq NP_114150
MIM 609852
UniProt ID Q9H2W2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MIXL1 Products

Required fields are marked with *

My Review for All MIXL1 Products

Required fields are marked with *

0
cart-icon