Recombinant Full Length Human MMD Protein, GST-tagged
Cat.No. : | MMD-6388HF |
Product Overview : | Human MMD full-length ORF ( NP_036461.2, 1 a.a. - 238 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 238 amino acids |
Description : | This protein is expressed by in vitro differentiated macrophages but not freshly isolated monocytes. Although sequence analysis identifies seven potential transmembrane domains, this protein has little homology to G-protein receptors and it has not been positively identified as a receptor. A suggested alternative function is that of an ion channel protein in maturing macrophages. [provided by RefSeq |
Molecular Mass : | 54.1 kDa |
AA Sequence : | MRFKNRFQRFMNHRAPANGRYKPTCYEHAANCYTHAFLIVPAIVGSALLHRLSDDCWEKITAWIYGMGLCALFIVSTVFHIVSWKKSHLRTVEHCFHMCDRMVIYFFIAASYAPWLNLRELGPLASHMRWFIWLMAAGGTIYVFLYHEKYKVVELFFYLTMGFSPALVVTSMNNTDGLQELACGGLIYCLGVVFFKSDGIIPFAHAIWHLFVATAAAVHYYAIWKYLYRSPTDFMRHL |
Applications : | Antibody Production Functional Study Compound Screening |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MMD monocyte to macrophage differentiation-associated [ Homo sapiens ] |
Official Symbol | MMD |
Synonyms | MMD; monocyte to macrophage differentiation-associated; monocyte to macrophage differentiation protein; MMA; PAQR11; macrophage maturation-associated; progestin and adipoQ receptor family member 11; progestin and adipoQ receptor family member XI; MMD1; |
Gene ID | 23531 |
mRNA Refseq | NM_012329 |
Protein Refseq | NP_036461 |
MIM | 604467 |
UniProt ID | Q15546 |
◆ Recombinant Proteins | ||
MMD-3706R | Recombinant Rat MMD Protein | +Inquiry |
MMD-9899M | Recombinant Mouse MMD Protein | +Inquiry |
MMD-3362R | Recombinant Rat MMD Protein, His (Fc)-Avi-tagged | +Inquiry |
MMD-5593M | Recombinant Mouse MMD Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL22845RF | Recombinant Full Length Rat Monocyte To Macrophage Differentiation Protein(Mmd) Protein, His-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MMD Products
Required fields are marked with *
My Review for All MMD Products
Required fields are marked with *