Recombinant Full Length Human MMP2 Protein, GST-tagged
Cat.No. : | MMP2-6516HF |
Product Overview : | Human MMP2 full-length ORF ( AAH02576.1, 1 a.a. - 660 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 660 amino acids |
Description : | Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMPs are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. This gene encodes an enzyme which degrades type IV collagen, the major structural component of basement membranes. The enzyme plays a role in endometrial menstrual breakdown, regulation of vascularization and the inflammatory response. Mutations in this gene have been associated with Winchester syndrome and Nodulosis-Arthropathy-Osteolysis (NAO) syndrome. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq |
Molecular Mass : | 100.3 kDa |
AA Sequence : | MEALMARGALTGPLRALCLLGCLLSHAAAAPSPIIKFPGDVAPKTDKELAVQYLNTFYGCPKESCNLFVLKDTLKKMQKFFGLPQTGDLDQNTIETMRKPRCGNPDVANYNFFPRKPKWDKNQITYRIIGYTPDLDPETVDDAFARAFQVWSDVTPLRFSRIHDGEADIMINFGRWEHGDGYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTLGEGQVVRVKYGNADGEYCKFPFLFNGKEYNSCTDTGRSDGFLWCSTTYNFEKDGKYGFCPHEALFTMGGNAEGQPCKFPFRFQGTSYDSCTTEGRTDGYRWCGTTEDYDRDKKYGFCPETAMSTVGGNSEGAPCVFPFTFLGNKYESCTSAGRSDGKMWCATTANYDDDRKWGFCPDQGYSLFLVAAHEFGHAMGLEHSQDPGALMAPIYTYTKNFRLSQDDIKGIQELYGASPDIDLGTGPTPTLGPVTPEICKQDIVFDGIAQIRGEIFFFKDRFIWRTVTPRDKPMGPLLVATFWPELPEKIDAVYEAPQEEKAVFFAGNEYWIYSASTLERGYPKPLTSLGLPPDVQRVDAAFNWSKNKKTYIFAGDKFWRYNEVKKKMDPGFPKLIADAWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWLGC |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MMP2 matrix metallopeptidase 2 (gelatinase A, 72kDa gelatinase, 72kDa type IV collagenase) [ Homo sapiens ] |
Official Symbol | MMP2 |
Synonyms | MMP2; matrix metallopeptidase 2 (gelatinase A, 72kDa gelatinase, 72kDa type IV collagenase); CLG4, CLG4A, matrix metalloproteinase 2 (gelatinase A, 72kD gelatinase, 72kD type IV collagenase) , matrix metalloproteinase 2 (gelatinase A, 72kDa gelatinase, 72kDa type IV collagenase); 72 kDa type IV collagenase; TBE 1; MMP-2; gelatinase A; 72 kDa gelatinase; collagenase type IV-A; neutrophil gelatinase; matrix metalloproteinase-2; matrix metalloproteinase-II; CLG4; MONA; CLG4A; TBE-1; MMP-II; |
Gene ID | 4313 |
mRNA Refseq | NM_001127891 |
Protein Refseq | NP_001121363 |
MIM | 120360 |
UniProt ID | P08253 |
◆ Recombinant Proteins | ||
MMP2-4564H | Recombinant Human MMP2 protein, His-tagged | +Inquiry |
MMP2-1120H | Recombinant Human MMP2 Protein, His-tagged | +Inquiry |
MMP2-12H | Active Recombinant Human MMP2 Protein (115-214, 393-447) | +Inquiry |
Mmp2-1784M | Recombinant Mouse Mmp2 Protein, His-tagged | +Inquiry |
Mmp2-4100M | Recombinant Mouse Mmp2 Protein, Myc/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
MMP2-46H | Native Human MMP-2 | +Inquiry |
MMP2-8455M | Native Mouse MMP2 | +Inquiry |
MMP2-47H | Native Human MMP-2/TIMP-2 Complex | +Inquiry |
MMP2-29475TH | Native Human MMP2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
MMP2-2380HCL | Recombinant Human MMP2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MMP2 Products
Required fields are marked with *
My Review for All MMP2 Products
Required fields are marked with *
0
Inquiry Basket