Recombinant Full Length Human MMP3 Protein, C-Flag-tagged
Cat.No. : | MMP3-890HFL |
Product Overview : | Recombinant Full Length Human MMP3 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. This gene encodes an enzyme which degrades fibronectin, laminin, collagens III, IV, IX, and X, and cartilage proteoglycans. The enzyme is thought to be involved in wound repair, progression of atherosclerosis, and tumor initiation. The gene is part of a cluster of MMP genes which localize to chromosome 11q22.3. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 52.2 kDa |
AA Sequence : | MKSLPILLLLCVAVCSAYPLDGAARGEDTSMNLVQKYLENYYDLEKDVKQFVRRKDSGPVVKKIREMQKF LGLEVTGKLDSDTLEVMRKPRCGVPDVGHFRTFPGIPKWRKTHLTYRIVNYTPDLPKDAVDSAVEKALKV WEEVTPLTFSRLYEGEADIMISFAVREHGDFYPFDGPGNVLAHAYAPGPGINGDAHFDDDEQWTKDTTGT NLFLVAAHEIGHSLGLFHSANTEALMYPLYHSLTDLTRFRLSQDDINGIQSLYGPPPDSPETPLVPTEPV PPEPGTPANCDPALSFDAVSTLRGEILIFKDRHFWRKSLRKLEPELHLISSFWPSLPSGVDAAYEVTSKD LVFIFKGNQFWAIRGNEVRAGYPRGIHTLGFPPTVRKIDAAISDKEKNKTYFFVEDKYWRFDEKRNSMEP GFPKQIAEDFPGIDSKIDAVFEEFGFFYFFTGSSQLEFDPNAKKVTHTLKSNSWLNCTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Protease |
Full Length : | Full L. |
Gene Name | MMP3 matrix metallopeptidase 3 [ Homo sapiens (human) ] |
Official Symbol | MMP3 |
Synonyms | SL-1; STMY; STR1; CHDS6; MMP-3; STMY1 |
Gene ID | 4314 |
mRNA Refseq | NM_002422.5 |
Protein Refseq | NP_002413.1 |
MIM | 185250 |
UniProt ID | P08254 |
◆ Recombinant Proteins | ||
MMP3-197H | Active Recombinant Human MMP3 protein | +Inquiry |
MMP3-2450H | Recombinant Human MMP3 Protein, His-tagged | +Inquiry |
MMP3-5433H | Recombinant Human MMP3 Protein, GST-tagged | +Inquiry |
MMP3-39H | Recombinant Human MMP3 | +Inquiry |
MMP3-5080H | Recombinant Human MMP3, His-tagged | +Inquiry |
◆ Native Proteins | ||
MMP3-26C | Collagenase Type 3 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
MMP3-4273HCL | Recombinant Human MMP3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MMP3 Products
Required fields are marked with *
My Review for All MMP3 Products
Required fields are marked with *
0
Inquiry Basket