Recombinant Full Length Human MND1 Protein, GST-tagged

• Cat.No.: MND1-5216HF
• Product Overview: Human GAJ full-length ORF ( AAH32142, 1 a.a. - 205 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 205 amino acids
• Description: The product of the MND1 gene associates with HOP2 (MIM 608665) to form a stable heterodimeric complex that binds DNA and stimulates the recombinase activity of RAD51 (MIM 179617) and DMC1 (MIM 602721) (Chi et al., 2007 [PubMed 17639080]). Both the MND1 and HOP2 genes are indispensable for meiotic recombination.[supplied by OMIM
• Molecular Mass: 48.29 kDa
• AA Sequence: MSKKKGLSAEEKRTRMMEIFSETKDVFQLKDLEKIAPKEKGITAMSVKEVLQSLVDDGMVDCERIGTSNYYWAFPSKALHARKHKLEVLESQLSEGSQKHASLQKSIEKAKIGRCETEERTRLAKELSSLRDQREQLKAEVEKYKDCDPQVVEEIRQANKVAKEAANRWTDNIFAIKSWAKRKFGFEENKIDRTFGIPEDFDYID
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MND1 meiotic nuclear divisions 1 homolog (S. cerevisiae) [ Homo sapiens ]
• Official Symbol: MND1
• Synonyms: MND1; meiotic nuclear divisions 1 homolog (S. cerevisiae); meiotic nuclear division protein 1 homolog; GAJ; homolog of yeast MND1
• Gene ID: 84057
• mRNA Refseq: NM_001253861
• Protein Refseq: NP_001240790
• MIM: 611422
• UniProt ID: Q9BWT6