Recombinant Human MND1 Protein, GST-tagged
| Cat.No. : | MND1-4669H | 
| Product Overview : | Human GAJ full-length ORF ( AAH32142, 1 a.a. - 205 a.a.) recombinant protein with GST-tag at N-terminal. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | Wheat Germ | 
| Tag : | GST | 
| Description : | The product of the MND1 gene associates with HOP2 (MIM 608665) to form a stable heterodimeric complex that binds DNA and stimulates the recombinase activity of RAD51 (MIM 179617) and DMC1 (MIM 602721) (Chi et al., 2007 [PubMed 17639080]). Both the MND1 and HOP2 genes are indispensable for meiotic recombination.[supplied by OMIM | 
| Molecular Mass : | 48.29 kDa | 
| AA Sequence : | MSKKKGLSAEEKRTRMMEIFSETKDVFQLKDLEKIAPKEKGITAMSVKEVLQSLVDDGMVDCERIGTSNYYWAFPSKALHARKHKLEVLESQLSEGSQKHASLQKSIEKAKIGRCETEERTRLAKELSSLRDQREQLKAEVEKYKDCDPQVVEEIRQANKVAKEAANRWTDNIFAIKSWAKRKFGFEENKIDRTFGIPEDFDYID | 
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array | 
| Notes : | Best use within three months from the date of receipt of this protein. | 
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. | 
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. | 
| Gene Name | MND1 meiotic nuclear divisions 1 homolog (S. cerevisiae) [ Homo sapiens ] | 
| Official Symbol | MND1 | 
| Synonyms | MND1; meiotic nuclear divisions 1 homolog (S. cerevisiae); meiotic nuclear division protein 1 homolog; GAJ; homolog of yeast MND1; | 
| Gene ID | 84057 | 
| mRNA Refseq | NM_001253861 | 
| Protein Refseq | NP_001240790 | 
| MIM | 611422 | 
| UniProt ID | Q9BWT6 | 
| ◆ Recombinant Proteins | ||
| MND1-9934M | Recombinant Mouse MND1 Protein | +Inquiry | 
| MND1-923H | Recombinant Human MND1, GST-tagged | +Inquiry | 
| MND1-5612M | Recombinant Mouse MND1 Protein, His (Fc)-Avi-tagged | +Inquiry | 
| MND1-4621C | Recombinant Chicken MND1 | +Inquiry | 
| MND1-2616R | Recombinant Rhesus Macaque MND1 Protein, His (Fc)-Avi-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| MND1-678HCL | Recombinant Human MND1 cell lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MND1 Products
Required fields are marked with *
My Review for All MND1 Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            