Recombinant Full Length Human MOB3B Protein, GST-tagged
Cat.No. : | MOB3B-6294HF |
Product Overview : | Human MOBKL2B full-length ORF ( NP_079037.3, 1 a.a. - 216 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 216 amino acids |
Description : | The protein encoded by this gene shares similarity with the yeast Mob1 protein. Yeast Mob1 binds Mps1p, a protein kinase essential for spindle pole body duplication and mitotic checkpoint regulation. This gene is located on the opposite strand as the interferon kappa precursor (IFNK) gene. [provided by RefSeq |
Molecular Mass : | 51.9 kDa |
AA Sequence : | MSIALKQVFNKDKTFRPKRKFEPGTQRFELHKRAQASLNSGVDLKAAVQLPSGEDQNDWVAVHVVDFFNRINLIYGTICEFCTERTCPVMSGGPKYEYRWQDDLKYKKPTALPAPQYMNLLMDWIEVQINNEEIFPTCVGVPFPKNFLQICKKILCRLFRVFVHVYIHHFDRVIVMGAEAHVNTCYKHFYYFVTEMNLIDRKELEPLKEMTSRMCH |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MOB3B MOB kinase activator 3B [ Homo sapiens (human) ] |
Official Symbol | MOB3B |
Synonyms | MOB3B; MOB kinase activator 3B; MOB1D; C9orf35; MOBKL2B; MOB kinase activator 3B; MOB kinase activator-like 2B; MOB1, Mps One Binder kinase activator-like 2B; mob1 homolog 2b; monopolar spindle 1 binding, MOB1, domain containing; mps one binder kinase activator-like 2B |
Gene ID | 79817 |
mRNA Refseq | NM_024761 |
Protein Refseq | NP_079037 |
MIM | 617652 |
UniProt ID | Q86TA1 |
◆ Recombinant Proteins | ||
MOB3B-6294HF | Recombinant Full Length Human MOB3B Protein, GST-tagged | +Inquiry |
MOB3B-5030H | Recombinant Human MOB3B, His-tagged | +Inquiry |
MOB3B-1296H | Recombinant Human MOB3B Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
MOB3B-5457H | Recombinant Human MOB3B Protein, GST-tagged | +Inquiry |
MOB3B-429H | Recombinant Human MOB kinase activator 3B, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MOB3B Products
Required fields are marked with *
My Review for All MOB3B Products
Required fields are marked with *
0
Inquiry Basket