Recombinant Human MOB3B Protein, GST-tagged

Cat.No. : MOB3B-5457H
Product Overview : Human MOBKL2B full-length ORF ( NP_079037.3, 1 a.a. - 216 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene shares similarity with the yeast Mob1 protein. Yeast Mob1 binds Mps1p, a protein kinase essential for spindle pole body duplication and mitotic checkpoint regulation. This gene is located on the opposite strand as the interferon kappa precursor (IFNK) gene. [provided by RefSeq
Molecular Mass : 51.9 kDa
AA Sequence : MSIALKQVFNKDKTFRPKRKFEPGTQRFELHKRAQASLNSGVDLKAAVQLPSGEDQNDWVAVHVVDFFNRINLIYGTICEFCTERTCPVMSGGPKYEYRWQDDLKYKKPTALPAPQYMNLLMDWIEVQINNEEIFPTCVGVPFPKNFLQICKKILCRLFRVFVHVYIHHFDRVIVMGAEAHVNTCYKHFYYFVTEMNLIDRKELEPLKEMTSRMCH
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MOB3B MOB kinase activator 3B [ Homo sapiens (human) ]
Official Symbol MOB3B
Synonyms MOB3B; MOB kinase activator 3B; MOB1D; C9orf35; MOBKL2B; MOB kinase activator 3B; MOB kinase activator-like 2B; MOB1, Mps One Binder kinase activator-like 2B; mob1 homolog 2b; monopolar spindle 1 binding, MOB1, domain containing; mps one binder kinase activator-like 2B
Gene ID 79817
mRNA Refseq NM_024761
Protein Refseq NP_079037
MIM 617652
UniProt ID Q86TA1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MOB3B Products

Required fields are marked with *

My Review for All MOB3B Products

Required fields are marked with *

0
cart-icon
0
compare icon