Recombinant Human MOB3B Protein, GST-tagged

• Cat.No.: MOB3B-5457H
• Product Overview: Human MOBKL2B full-length ORF ( NP_079037.3, 1 a.a. - 216 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The protein encoded by this gene shares similarity with the yeast Mob1 protein. Yeast Mob1 binds Mps1p, a protein kinase essential for spindle pole body duplication and mitotic checkpoint regulation. This gene is located on the opposite strand as the interferon kappa precursor (IFNK) gene. [provided by RefSeq
• Molecular Mass: 51.9 kDa
• AA Sequence: MSIALKQVFNKDKTFRPKRKFEPGTQRFELHKRAQASLNSGVDLKAAVQLPSGEDQNDWVAVHVVDFFNRINLIYGTICEFCTERTCPVMSGGPKYEYRWQDDLKYKKPTALPAPQYMNLLMDWIEVQINNEEIFPTCVGVPFPKNFLQICKKILCRLFRVFVHVYIHHFDRVIVMGAEAHVNTCYKHFYYFVTEMNLIDRKELEPLKEMTSRMCH
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MOB3B MOB kinase activator 3B [ Homo sapiens (human) ]
• Official Symbol: MOB3B
• Synonyms: MOB3B; MOB kinase activator 3B; MOB1D; C9orf35; MOBKL2B; MOB kinase activator 3B; MOB kinase activator-like 2B; MOB1, Mps One Binder kinase activator-like 2B; mob1 homolog 2b; monopolar spindle 1 binding, MOB1, domain containing; mps one binder kinase activator-like 2B
• Gene ID: 79817
• mRNA Refseq: NM_024761
• Protein Refseq: NP_079037
• MIM: 617652
• UniProt ID: Q86TA1