Recombinant Full Length Human MOBP Protein, GST-tagged

Cat.No. : MOBP-6297HF
Product Overview : Human MOBP full-length ORF ( AAH22471, 1 a.a. - 81 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 81 amino acids
Description : MOBP (Myelin-Associated Oligodendrocyte Basic Protein) is a Protein Coding gene. Diseases associated with MOBP include Substance Abuse and Corticobasal Degeneration. GO annotations related to this gene include Rab GTPase binding and structural constituent of myelin sheath. An important paralog of this gene is MYRIP.
Molecular Mass : 34.65 kDa
AA Sequence : MSQKPAKEGPRLSKNQKYSEHFSIHCCPPFTFLNSKKEIVDRKYSICKSGCFYQKKEEDWICCACQKTRLKRKIRPTPKKK
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MOBP myelin-associated oligodendrocyte basic protein [ Homo sapiens ]
Official Symbol MOBP
Synonyms MOBP; myelin-associated oligodendrocyte basic protein; MGC87379;
Gene ID 4336
mRNA Refseq NM_182935
Protein Refseq NP_891980
MIM 600948
UniProt ID Q13875

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MOBP Products

Required fields are marked with *

My Review for All MOBP Products

Required fields are marked with *

0
cart-icon
0
compare icon