Recombinant Full Length Human MOGAT2 Protein, GST-tagged
Cat.No. : | MOGAT2-6304HF |
Product Overview : | Human MOGAT2 full-length ORF ( AAI03879.1, 1 a.a. - 284 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 284 amino acids |
Description : | Dietary fat absorption from the small intestine is facilitated by acyl-CoA:monoacylglycerol transferase (MOGAT; EC 2.3.1.22) and acyl-CoA:diacylglycerol acyltransferase (DGAT; see MIM 604900) activities. MOGAT catalyzes the joining of monoacylglycerol and fatty acyl-CoAs to form diacylglycerol (Yen and Farese, 2003 [PubMed 12621063]).[supplied by OMIM |
Molecular Mass : | 58.7 kDa |
AA Sequence : | MVEFAPLFMPWERRLQTLAVLQFVFSFLALAEICTVGFIALLFTRFWLLTVLYAAWWYLDRDKPRQGGRHIQAIRCWTIWKYMKDYFPISLVKTAELDPSRNYIAGFHPHGVLAVGAFANLCTESTGFSSIFPGIRPHLMMLTLWFRAPFFRDYIMSAGLVTSEKESAAHILNRKGGGNLLGIIVGGAQEALDARPGSFTLLLRNRKGFVRLALTHGYQASGKSTLGSVGNWQGFYFGGKMAETNADSILVEIFSPFTIKIIFWCLMPKYLEKFPQRRLSDLRN |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MOGAT2 monoacylglycerol O-acyltransferase 2 [ Homo sapiens ] |
Official Symbol | MOGAT2 |
Synonyms | MOGAT2; monoacylglycerol O-acyltransferase 2; 2-acylglycerol O-acyltransferase 2; DGAT2L5; FLJ22644; MGAT2; hDC5; hMGAT2; acyl CoA:monoacylglycerol acyltransferase 2; acyl-CoA:monoacylglycerol acyltransferase 2; diacylglycerol O-acyltransferase candidate 5; diacylglycerol acyltransferase 2-like protein 5; MGC119183; MGC119184; MGC119185; |
Gene ID | 80168 |
mRNA Refseq | NM_025098 |
Protein Refseq | NP_079374 |
MIM | 610270 |
UniProt ID | Q3SYC2 |
◆ Cell & Tissue Lysates | ||
MOGAT2-4258HCL | Recombinant Human MOGAT2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MOGAT2 Products
Required fields are marked with *
My Review for All MOGAT2 Products
Required fields are marked with *