Recombinant Full Length Human MOGAT2 Protein, GST-tagged

Cat.No. : MOGAT2-6304HF
Product Overview : Human MOGAT2 full-length ORF ( AAI03879.1, 1 a.a. - 284 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 284 amino acids
Description : Dietary fat absorption from the small intestine is facilitated by acyl-CoA:monoacylglycerol transferase (MOGAT; EC 2.3.1.22) and acyl-CoA:diacylglycerol acyltransferase (DGAT; see MIM 604900) activities. MOGAT catalyzes the joining of monoacylglycerol and fatty acyl-CoAs to form diacylglycerol (Yen and Farese, 2003 [PubMed 12621063]).[supplied by OMIM
Molecular Mass : 58.7 kDa
AA Sequence : MVEFAPLFMPWERRLQTLAVLQFVFSFLALAEICTVGFIALLFTRFWLLTVLYAAWWYLDRDKPRQGGRHIQAIRCWTIWKYMKDYFPISLVKTAELDPSRNYIAGFHPHGVLAVGAFANLCTESTGFSSIFPGIRPHLMMLTLWFRAPFFRDYIMSAGLVTSEKESAAHILNRKGGGNLLGIIVGGAQEALDARPGSFTLLLRNRKGFVRLALTHGYQASGKSTLGSVGNWQGFYFGGKMAETNADSILVEIFSPFTIKIIFWCLMPKYLEKFPQRRLSDLRN
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MOGAT2 monoacylglycerol O-acyltransferase 2 [ Homo sapiens ]
Official Symbol MOGAT2
Synonyms MOGAT2; monoacylglycerol O-acyltransferase 2; 2-acylglycerol O-acyltransferase 2; DGAT2L5; FLJ22644; MGAT2; hDC5; hMGAT2; acyl CoA:monoacylglycerol acyltransferase 2; acyl-CoA:monoacylglycerol acyltransferase 2; diacylglycerol O-acyltransferase candidate 5; diacylglycerol acyltransferase 2-like protein 5; MGC119183; MGC119184; MGC119185;
Gene ID 80168
mRNA Refseq NM_025098
Protein Refseq NP_079374
MIM 610270
UniProt ID Q3SYC2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MOGAT2 Products

Required fields are marked with *

My Review for All MOGAT2 Products

Required fields are marked with *

0
cart-icon
0
compare icon