Recombinant Full Length Xenopus Tropicalis 2-Acylglycerol O-Acyltransferase 2(Mogat2) Protein, His-Tagged
| Cat.No. : | RFL4729XF |
| Product Overview : | Recombinant Full Length Xenopus tropicalis 2-acylglycerol O-acyltransferase 2(mogat2) Protein (Q5M8H5) (1-335aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length (1-335) |
| Form : | Lyophilized powder |
| AA Sequence : | MWIHFAPLKIPFSRRLQTGAVLQWAVSFLAMAQCCIALYILLLFSRYWYLAVLYGVWLYI DWDTPSKGGRRSNWVRSWTVWKYFAEYFPIKLLCTAPLDPKYNYIMGFHPHGVLVVGAFG NFCTEGTGFSRLFPGLTPHLLMLPAWFRVPFFREYIMSGSLVSSDRSSAHHLLSQKSGGQ ALVIAVGGPPEALDAKPGELTLQLLNRTGFIKMALTHGAHLVPVLSFGENDLYNQVNNPR GSLLRATQEKLQKIFGIALPLFHGRGVFQYSWGLLPHRRPIYTVVGSPIHVTKTPCPTRE QISSLHSLYIAKLRDLFETHKGNYGIPEDRSLVLC |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | mogat2 |
| Synonyms | mogat2; 2-acylglycerol O-acyltransferase 2; Acyl-CoA:monoacylglycerol acyltransferase 2; MGAT2; Monoacylglycerol O-acyltransferase 2 |
| UniProt ID | Q5M8H5 |
| ◆ Recombinant Proteins | ||
| MOGAT2-5468H | Recombinant Human MOGAT2 Protein, GST-tagged | +Inquiry |
| MOGAT2-1591Z | Recombinant Zebrafish MOGAT2 | +Inquiry |
| MOGAT2-6304HF | Recombinant Full Length Human MOGAT2 Protein, GST-tagged | +Inquiry |
| RFL5567HF | Recombinant Full Length Human 2-Acylglycerol O-Acyltransferase 2(Mogat2) Protein, His-Tagged | +Inquiry |
| RFL12366MF | Recombinant Full Length Mouse 2-Acylglycerol O-Acyltransferase 2(Mogat2) Protein, His-Tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MOGAT2-4258HCL | Recombinant Human MOGAT2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All mogat2 Products
Required fields are marked with *
My Review for All mogat2 Products
Required fields are marked with *
