Recombinant Full Length Human MOSPD1 Protein, GST-tagged

• Cat.No.: MOSPD1-6315HF
• Product Overview: Human MOSPD1 full-length ORF ( NP_062456.1, 1 a.a. - 213 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 213 amino acids
• Description: MOSPD1 (Motile Sperm Domain Containing 1) is a Protein Coding gene. Diseases associated with MOSPD1 include Conotruncal Heart Malformations. GO annotations related to this gene include structural molecule activity. An important paralog of this gene is MOSPD3.
• Molecular Mass: 50.5 kDa
• AA Sequence: MHQQKRQPELVEGNLPVFVFPTELIFYADDQSTHKQVLTLYNPYEFALKFKVLCTTPNKYVVVDAAGAVKPQCCVDIVIRHRDVRSCHYGVIDKFRLQVSEQSQRKALGRKEVVATLLPSAKEQQKEEEEKRLKEHLTESLFFEQSFQPENRAVSSGPSLLTVFLGVVCIAALMLPTLGDVESLVPLYLHLSVNQKLVAAYILGLITMAILRT
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MOSPD1 motile sperm domain containing 1 [ Homo sapiens ]
• Official Symbol: MOSPD1
• Synonyms: DJ473B4; MOSPD1; motile sperm domain containing 1
• Gene ID: 56180
• mRNA Refseq: NM_019556
• Protein Refseq: NP_062456
• MIM: 300674
• UniProt ID: Q9UJG1