Recombinant Full Length Human MPHOSPH6 Protein, GST-tagged
| Cat.No. : | MPHOSPH6-6321HF |
| Product Overview : | Human MPHOSPH6 full-length ORF ( AAH05242, 1 a.a. - 160 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 160 amino acids |
| Description : | MPHOSPH6 (M-Phase Phosphoprotein 6) is a Protein Coding gene. Among its related pathways are Deadenylation-dependent mRNA decay and rRNA processing in the nucleus and cytosol. GO annotations related to this gene include RNA binding. |
| Molecular Mass : | 43.34 kDa |
| AA Sequence : | MAAERKTKLSKNLLRMKFMQRGLDSETKKQLEEEEKKIISEEHWYLDLPELKEKESFIIEEQSFLLCEDLLYGRMSFRGFNPEVEKLMLQMNAKHKAEEVEDETVELDVSDEEMARRYETLVGTIGKKFARKRDHANYEEDENGDITPIKAKKMFLKPQD |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | MPHOSPH6 M-phase phosphoprotein 6 [ Homo sapiens ] |
| Official Symbol | MPHOSPH6 |
| Synonyms | MPHOSPH6; M-phase phosphoprotein 6; MPP6; MPP; MPP-6; |
| Gene ID | 10200 |
| mRNA Refseq | NM_005792 |
| Protein Refseq | NP_005783 |
| MIM | 605500 |
| UniProt ID | Q99547 |
| ◆ Recombinant Proteins | ||
| MPHOSPH6-2813R | Recombinant Rhesus monkey MPHOSPH6 Protein, His-tagged | +Inquiry |
| MPHOSPH6-5648M | Recombinant Mouse MPHOSPH6 Protein, His (Fc)-Avi-tagged | +Inquiry |
| MPHOSPH6-6321HF | Recombinant Full Length Human MPHOSPH6 Protein, GST-tagged | +Inquiry |
| MPHOSPH6-9984M | Recombinant Mouse MPHOSPH6 Protein | +Inquiry |
| MPHOSPH6-2633R | Recombinant Rhesus Macaque MPHOSPH6 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MPHOSPH6-4238HCL | Recombinant Human MPHOSPH6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MPHOSPH6 Products
Required fields are marked with *
My Review for All MPHOSPH6 Products
Required fields are marked with *
