Recombinant Full Length Human MPV17 Protein
Cat.No. : | MPV17-312HF |
Product Overview : | Recombinant full length Human MPV17 with N terminal proprietary tag; Predicted MWt 45.43 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Protein Length : | 176 amino acids |
Description : | This gene encodes a mitochondrial inner membrane protein that is implicated in the metabolism of reactive oxygen species. Mutations in this gene have been associated with the hepatocerebral form of mitochondrial DNA depletion syndrome (MDDS). |
Form : | Liquid |
Molecular Mass : | 45.430kDa inclusive of tags |
AA Sequence : | MALWRAYQRALAAHPWKVQVLTAGSLMGLGDIISQQLVER RGLQEHQRGRTLTMVSLGCGFVGPVVGGWYKVLDRFIPGT TKVDALKKMLLDQGGFAPCFLGCFLPLVGALNGLSAQDNW AKLQRDYPDALITNYYLWPAVQLANFYLVPLHYRLAVVQC VAVIWNSYLSWKAHRL |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name | MPV17 MpV17 mitochondrial inner membrane protein [ Homo sapiens ] |
Official Symbol | MPV17 |
Synonyms | MPV17; MpV17 mitochondrial inner membrane protein; MpV17 transgene, murine homolog, glomerulosclerosis; protein Mpv17;glomerulosclerosis; SYM1; |
Gene ID | 4358 |
mRNA Refseq | NM_002437 |
Protein Refseq | NP_002428 |
MIM | 137960 |
UniProt ID | P39210 |
◆ Recombinant Proteins | ||
MPV17-312HF | Recombinant Full Length Human MPV17 Protein | +Inquiry |
MPV17-11382Z | Recombinant Zebrafish MPV17 | +Inquiry |
RFL33637XF | Recombinant Full Length Xenopus Laevis Protein Mpv17(Mpv17) Protein, His-Tagged | +Inquiry |
RFL33288BF | Recombinant Full Length Bovine Protein Mpv17(Mpv17) Protein, His-Tagged | +Inquiry |
RFL4587RF | Recombinant Full Length Rat Protein Mpv17(Mpv17) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MPV17-4222HCL | Recombinant Human MPV17 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MPV17 Products
Required fields are marked with *
My Review for All MPV17 Products
Required fields are marked with *