Recombinant Full Length Human MPV17L2 Protein
Cat.No. : | MPV17L2-6336HF |
Product Overview : | Human MPV17L2 full-length ORF (ADZ15803.1) recombinant protein without tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Protein Length : | 888 amino acids |
Description : | MPV17L2 (MPV17 Mitochondrial Inner Membrane Protein Like 2) is a Protein Coding gene. Among its related pathways are Peroxisome. An important paralog of this gene is MPV17. |
Form : | Liquid |
Molecular Mass : | 20 kDa |
AA Sequence : | MARGGWRRLRRLLSAGQLLFQGRALLVTNTLGCGALMAAGDGVRQSWEIRARPGQVFDPRRSASMFAVGCSMGPFLHYWYLSLDRLFPASGLRGFPNVLKKVLVDQLVASPLLGVWEFYKADWCVWPAAQFVNFLFVPPQFRVTYINGLTLGWDTYLSYLKYRSPVPLTPPGCVALDTRAD |
Applications : | Antibody Production Functional Study Compound Screening |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 25 mM Tris-HCl of pH8.0 containing 2% glycerol. |
Gene Name | MPV17L2 MPV17 mitochondrial membrane protein-like 2 [ Homo sapiens ] |
Official Symbol | MPV17L2 |
Synonyms | MPV17L2; MPV17 mitochondrial membrane protein-like 2; mpv17-like protein 2; FKSG24; MGC12972; MGC110861; |
Gene ID | 84769 |
mRNA Refseq | NM_032683 |
Protein Refseq | NP_116072 |
MIM | 616133 |
UniProt ID | Q567V2 |
◆ Recombinant Proteins | ||
MPV17L2-2639R | Recombinant Rhesus Macaque MPV17L2 Protein, His (Fc)-Avi-tagged | +Inquiry |
MPV17L2-5523H | Recombinant Human MPV17L2 Protein | +Inquiry |
MPV17L2-10003M | Recombinant Mouse MPV17L2 Protein | +Inquiry |
MPV17L2-6336HF | Recombinant Full Length Human MPV17L2 Protein | +Inquiry |
RFL36537HF | Recombinant Full Length Human Mpv17-Like Protein 2(Mpv17L2) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MPV17L2-4220HCL | Recombinant Human MPV17L2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MPV17L2 Products
Required fields are marked with *
My Review for All MPV17L2 Products
Required fields are marked with *