Recombinant Full Length Human MR1 Protein, C-Flag-tagged
Cat.No. : | MR1-609HFL |
Product Overview : | Recombinant Full Length Human MR1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | MAIT (mucosal-associated invariant T-cells) lymphocytes represent a small population of T-cells primarily found in the gut. The protein encoded by this gene is an antigen-presenting molecule that presents metabolites of microbial vitamin B to MAITs. This presentation may activate the MAITs to regulate the amounts of specific types of bacteria in the gut. Several transcript variants encoding different isoforms have been found for this gene, and a pseudogene of it has been detected about 36 kbp upstream on the same chromosome. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 39.2 kDa |
AA Sequence : | MGELMAFLLPLIIVLMVKHSDSRTHSLRYFRLGVSDPIRGVPEFISVGYVDSHPITTYDSVTRQKEPRAP WMAENLAPDHWERYTQLLRGWQQMFKVELKRLQRHYNHSGSHTYQRMIGCELLEDGSTTGFLQYAYDGQD FLIFNKDTLSWLAVDNVAHTIKQAWEANQHELLYQKNWLEEECIAWLKRFLEYGKDTLQRTEPPLVRVNR KETFPGVTALFCKAHGFYPPEIYMTWMKNGEEIVQEIDYGDILPSGDGTYQAWASIELDPQSSNLYSCHV EHCGVHMVLQVPQESETIPLVMKAVSGSIVLVIVLAGVGVLVWRRRPREQNGAIYLPTPDRTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Transmembrane |
Full Length : | Full L. |
Gene Name | MR1 major histocompatibility complex, class I-related [ Homo sapiens (human) ] |
Official Symbol | MR1 |
Synonyms | HLALS |
Gene ID | 3140 |
mRNA Refseq | NM_001531.3 |
Protein Refseq | NP_001522.1 |
MIM | 600764 |
UniProt ID | Q95460 |
◆ Recombinant Proteins | ||
MR1-3404R | Recombinant Rat MR1 Protein, His (Fc)-Avi-tagged | +Inquiry |
MR1-1428H | Recombinant Human MR1 Protein, His (Fc)-Avi-tagged | +Inquiry |
MR1-3746R | Recombinant Rat MR1 Protein | +Inquiry |
MR1-609HFL | Recombinant Full Length Human MR1 Protein, C-Flag-tagged | +Inquiry |
Mr1-1091M | Recombinant Mouse Mr1 Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MR1-4215HCL | Recombinant Human MR1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MR1 Products
Required fields are marked with *
My Review for All MR1 Products
Required fields are marked with *
0
Inquiry Basket