Recombinant Human MR1 Protein, GST-tagged
Cat.No. : | MR1-5529H |
Product Overview : | Human MR1 partial ORF ( NP_001522, 201 a.a. - 300 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | MAIT (mucosal-associated invariant T-cells) lymphocytes represent a small population of T-cells primarily found in the gut. The protein encoded by this gene is an antigen-presenting molecule that presents metabolites of microbial vitamin B to MAITs. This presentation may activate the MAITs to regulate the amounts of specific types of bacteria in the gut. Several transcript variants encoding different isoforms have been found for this gene, and a pseudogene of it has been detected about 36 kbp upstream on the same chromosome. [provided by RefSeq, Jul 2015] |
Molecular Mass : | 36.74 kDa |
AA Sequence : | TEPPLVRVNRKETFPGVTALFCKAHGFYPPEIYMTWMKNGEEIVQEIDYGDILPSGDGTYQAWASIELDPQSSNLYSCHVEHCGVHMVLQVPQESETIPL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MR1 major histocompatibility complex, class I-related [ Homo sapiens ] |
Official Symbol | MR1 |
Synonyms | MR1; major histocompatibility complex, class I-related; HLALS, major histocompatibility complex, class I like sequence; major histocompatibility complex class I-related gene protein; MHC class I-like antigen MR-1; MHC class I-related gene protein; MHC class-I related-gene protein; class I histocompatibility antigen-like protein; major histocompatibility complex, class I-like sequence; HLALS; FLJ31593; |
Gene ID | 3140 |
mRNA Refseq | NM_001194999 |
Protein Refseq | NP_001181928 |
MIM | 600764 |
UniProt ID | Q95460 |
◆ Recombinant Proteins | ||
MR1-964H | Recombinant Human MR1, GST-tagged | +Inquiry |
MR1-1428H | Recombinant Human MR1 Protein, His (Fc)-Avi-tagged | +Inquiry |
MR1-01H | Recombinant Human MR1 Protein, Myc/DDK-tagged | +Inquiry |
MR1-5529H | Recombinant Human MR1 Protein, GST-tagged | +Inquiry |
MR1-5661M | Recombinant Mouse MR1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MR1-4215HCL | Recombinant Human MR1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MR1 Products
Required fields are marked with *
My Review for All MR1 Products
Required fields are marked with *