Recombinant Human MR1 Protein, GST-tagged

Cat.No. : MR1-5529H
Product Overview : Human MR1 partial ORF ( NP_001522, 201 a.a. - 300 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : MAIT (mucosal-associated invariant T-cells) lymphocytes represent a small population of T-cells primarily found in the gut. The protein encoded by this gene is an antigen-presenting molecule that presents metabolites of microbial vitamin B to MAITs. This presentation may activate the MAITs to regulate the amounts of specific types of bacteria in the gut. Several transcript variants encoding different isoforms have been found for this gene, and a pseudogene of it has been detected about 36 kbp upstream on the same chromosome. [provided by RefSeq, Jul 2015]
Molecular Mass : 36.74 kDa
AA Sequence : TEPPLVRVNRKETFPGVTALFCKAHGFYPPEIYMTWMKNGEEIVQEIDYGDILPSGDGTYQAWASIELDPQSSNLYSCHVEHCGVHMVLQVPQESETIPL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MR1 major histocompatibility complex, class I-related [ Homo sapiens ]
Official Symbol MR1
Synonyms MR1; major histocompatibility complex, class I-related; HLALS, major histocompatibility complex, class I like sequence; major histocompatibility complex class I-related gene protein; MHC class I-like antigen MR-1; MHC class I-related gene protein; MHC class-I related-gene protein; class I histocompatibility antigen-like protein; major histocompatibility complex, class I-like sequence; HLALS; FLJ31593;
Gene ID 3140
mRNA Refseq NM_001194999
Protein Refseq NP_001181928
MIM 600764
UniProt ID Q95460

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MR1 Products

Required fields are marked with *

My Review for All MR1 Products

Required fields are marked with *

0
cart-icon
0
compare icon