Recombinant Full Length Human MRE11A Protein
Cat.No. : | MRE11A-315HF |
Product Overview : | Recombinant full length Human Mre11 protein with an N terminal proprietary tag; predicted MWt: 48.77 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Protein Length : | 206 amino acids |
Description : | This gene encodes a nuclear protein involved in homologous recombination, telomere length maintenance, and DNA double-strand break repair. By itself, the protein has 3 to 5 exonuclease activity and endonuclease activity. The protein forms a complex with the RAD50 homolog; this complex is required for nonhomologous joining of DNA ends and possesses increased single-stranded DNA endonuclease and 3 to 5 exonuclease activities. In conjunction with a DNA ligase, this protein promotes the joining of noncomplementary ends in vitro using short homologies near the ends of the DNA fragments. This gene has a pseudogene on chromosome 3. Alternative splicing of this gene results in two transcript variants encoding different isoforms. |
Form : | Liquid |
Molecular Mass : | 48.770kDa inclusive of tags |
AA Sequence : | MSTADALDDENTFKILVATDIHLGFMEKDAVRGNDTFVTL DEILRLAQENEVDFILLGGDLFHENKPSRKTLHTCLELLR KYCMGDRPVQFEILSDQSVNFGFSKFPWVNYQDGNLNISI PVFSIHGNHDDPTGADALCALDILSCAGFVNHFGRSMSVE KIDISPVLLQKGRTKIALYGLGSIPDERLYRMFVNKKVTM LRPKED |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name | MRE11A MRE11 meiotic recombination 11 homolog A (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | MRE11A |
Synonyms | MRE11A; MRE11 meiotic recombination 11 homolog A (S. cerevisiae); meiotic recombination (S. cerevisiae) 11 homolog A , MRE11; double-strand break repair protein MRE11A; AT like disease; ATLD |
Gene ID | 4361 |
mRNA Refseq | NM_005590 |
Protein Refseq | NP_005581 |
MIM | 600814 |
UniProt ID | P49959 |
◆ Recombinant Proteins | ||
MRE11A-315HF | Recombinant Full Length Human MRE11A Protein | +Inquiry |
Mre11a-4136M | Recombinant Mouse Mre11a Protein, Myc/DDK-tagged | +Inquiry |
MRE11A-6354HF | Recombinant Full Length Human MRE11A Protein, GST-tagged | +Inquiry |
MRE11A-212Z | Recombinant Zebrafish MRE11A | +Inquiry |
MRE11A-6342C | Recombinant Chicken MRE11A | +Inquiry |
◆ Cell & Tissue Lysates | ||
MRE11A-4211HCL | Recombinant Human MRE11A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MRE11A Products
Required fields are marked with *
My Review for All MRE11A Products
Required fields are marked with *