Recombinant Full Length Human MRGPRD Protein, GST-tagged
Cat.No. : | MRGPRD-6358HF |
Product Overview : | Human MRGPRD full-length ORF ( NP_944605.2, 1 a.a. - 321 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 321 amino acids |
Description : | MRGPRD (MAS Related GPR Family Member D) is a Protein Coding gene. Among its related pathways are ACE Inhibitor Pathway, Pharmacodynamics. GO annotations related to this gene include G-protein coupled receptor activity. An important paralog of this gene is MRGPRX4. |
Molecular Mass : | 62.5 kDa |
AA Sequence : | MNQTLNSSGTVESALNYSRGSTVHTAYLVLSSLAMFTCLCGMAGNSMVIWLLGFRMHRNPFCIYILNLAAADLLFLFSMASTLSLETQPLVNTTDKVHELMKRLMYFAYTVGLSLLTAISTQRCLSVLFPIWFKCHRPRHLSAWVCGLLWTLCLLMNGLTSSFCSKFLKFNEDRCFRVDMVQAALIMGVLTPVMTLSSLTLFVWVRRSSQQWRRQPTRLFVVVLASVLVFLICSLPLSIYWFVLYWLSLPPEMQVLCFSLSRLSSSVSSSANPVIYFLVGSRRSHRLPTRSLGTVLQQALREEPELEGGETPTVGTNEMGA |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MRGPRD MAS-related GPR, member D [ Homo sapiens ] |
Official Symbol | MRGPRD |
Synonyms | MRGPRD; MAS-related GPR, member D; mas-related G-protein coupled receptor member D; mrgD; beta-alanine receptor; G-protein coupled receptor TGR7; mas-related G protein-coupled MRGD; MRGD; TGR7; |
Gene ID | 116512 |
mRNA Refseq | NM_198923 |
Protein Refseq | NP_944605 |
MIM | 607231 |
UniProt ID | Q8TDS7 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MRGPRD Products
Required fields are marked with *
My Review for All MRGPRD Products
Required fields are marked with *
0
Inquiry Basket