Recombinant Full Length Human MRPL11 Protein, C-Flag-tagged
| Cat.No. : | MRPL11-923HFL |
| Product Overview : | Recombinant Full Length Human MRPL11 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Mammalian Cells |
| Tag : | Flag |
| Description : | This nuclear gene encodes a 39S subunit component of the mitochondial ribosome. Alternative splicing results in multiple transcript variants. Pseudogenes for this gene are found on chromosomes 5 and 12. |
| Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
| Molecular Mass : | 20.5 kDa |
| AA Sequence : | MSKLGRAARGLRKPEVGGVIRAIVRAGLAMPGPPLGPVLGQRGVSINQFCKEFNERTKDIKEGIPLPTKI LVKPDRTFEIKIGQPTVSYFLKAAAGIEKGARQTGKEVAGLVTLKHVYEIARIKAQDEAFALQDVPLSSV VRSIIGSARSLGIRVVKDLSSEELAAFQKERAIFLAAQKEADLAAQEEAAKKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
| Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Storage : | Store at -80 centigrade. |
| Concentration : | >50 ug/mL as determined by microplate BCA method. |
| Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Full Length : | Full L. |
| Gene Name | MRPL11 mitochondrial ribosomal protein L11 [ Homo sapiens (human) ] |
| Official Symbol | MRPL11 |
| Synonyms | L11MT; CGI-113; MRP-L11 |
| Gene ID | 65003 |
| mRNA Refseq | NM_016050.5 |
| Protein Refseq | NP_057134.1 |
| MIM | 611826 |
| UniProt ID | Q9Y3B7 |
| ◆ Recombinant Proteins | ||
| MRPL11-1432H | Recombinant Human MRPL11 Protein, His (Fc)-Avi-tagged | +Inquiry |
| MRPL11-5000H | Recombinant Human MRPL11 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| MRPL11-2652R | Recombinant Rhesus Macaque MRPL11 Protein, His (Fc)-Avi-tagged | +Inquiry |
| MRPL11-2832R | Recombinant Rhesus monkey MRPL11 Protein, His-tagged | +Inquiry |
| MRPL11-3762R | Recombinant Rat MRPL11 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MRPL11-4198HCL | Recombinant Human MRPL11 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MRPL11 Products
Required fields are marked with *
My Review for All MRPL11 Products
Required fields are marked with *
