Recombinant Full Length Human MRPL28 Protein, GST-tagged
Cat.No. : | MRPL28-6435HF |
Product Overview : | Human MRPL28 full-length ORF ( NP_006419.2, 1 a.a. - 256 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 256 amino acids |
Description : | Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein, a part of which was originally isolated by its ability to recognize tyrosinase in an HLA-A24-restricted fashion. [provided by RefSeq |
Molecular Mass : | 56.6 kDa |
AA Sequence : | MPLHKYPVWLWKRLQLREGICSRLPGHYLRSLEEERTPTPVHYRPHGAKFKINPKNGQRERVEDVPIPIYFPPESQRGLWGGEGWILGQIYANNDKLSKRLKKVWKPQLFEREFYSEILDKKFTVTVTMRTLDLIDEAYGLDFYILKTPKEDLCSKFGMDLKRGMLLRLARQDPQLHPEDPERRAAIYDKYKEFAIPEEEAEWVGLTLEEAIEKQRLLEEKDPVPLFKIYVAELIQQLQQQALSEPAVVQKRASGQ |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MRPL28 mitochondrial ribosomal protein L28 [ Homo sapiens ] |
Official Symbol | MRPL28 |
Synonyms | MRPL28; mitochondrial ribosomal protein L28; MAAT1, melanoma associated antigen recognised by cytotoxic T lymphocytes; 39S ribosomal protein L28, mitochondrial; p15; L28mt; MRP-L28; melanoma antigen p15; melanoma-associated antigen recognized by T lymphocytes; melanoma-associated antigen recognized by T-lymphocytes; melanoma-associated antigen recognised by cytotoxic T lymphocytes; MAAT1; MGC8499; |
Gene ID | 10573 |
mRNA Refseq | NM_006428 |
Protein Refseq | NP_006419 |
MIM | 604853 |
UniProt ID | Q13084 |
◆ Recombinant Proteins | ||
MRPL28-4415H | Recombinant Human MRPL28 protein, GST-tagged | +Inquiry |
MRPL28-10057M | Recombinant Mouse MRPL28 Protein | +Inquiry |
Mrpl28-4151M | Recombinant Mouse Mrpl28 Protein, Myc/DDK-tagged | +Inquiry |
MRPL28-6435HF | Recombinant Full Length Human MRPL28 Protein, GST-tagged | +Inquiry |
MRPL28-3004Z | Recombinant Zebrafish MRPL28 | +Inquiry |
◆ Cell & Tissue Lysates | ||
MRPL28-4182HCL | Recombinant Human MRPL28 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MRPL28 Products
Required fields are marked with *
My Review for All MRPL28 Products
Required fields are marked with *