Recombinant Full Length Human MRPS10 Protein, GST-tagged
| Cat.No. : | MRPS10-6450HF |
| Product Overview : | Human MRPS10 full-length ORF ( NP_060611.2, 1 a.a. - 201 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 201 amino acids |
| Description : | Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein that belongs to the ribosomal protein S10P family. Pseudogenes corresponding to this gene are found on chromosomes 1q, 3p, and 9p. [provided by RefSeq |
| Molecular Mass : | 49.4 kDa |
| AA Sequence : | MAARTAFGAVCRRLWQGLGNFSVNTSKGNTAKNGGLLLSTNMKWVQFSNLHVDVPKDLTKPVVTISDEPDILYKRLSVLVKGHDKAVLDSYEYFAVLAAKELGISIKVHEPPRKIERFTLLQSVHIYKKHRVQYEMRTLYRCLELEHLTGSTADVYLEYIQRNLPEGVAMEVTKTQLEQLPEHIKEPIWETLSEEKEESKS |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | MRPS10 mitochondrial ribosomal protein S10 [ Homo sapiens ] |
| Official Symbol | MRPS10 |
| Synonyms | MRPS10; mitochondrial ribosomal protein S10; |
| Gene ID | 64964 |
| ◆ Recombinant Proteins | ||
| MRPS10-4961C | Recombinant Chicken MRPS10 | +Inquiry |
| mRpS10-563F | Recombinant Fruit fly mRpS10 protein, His-tagged | +Inquiry |
| MRPS10-3777R | Recombinant Rat MRPS10 Protein | +Inquiry |
| MRPS10-5599H | Recombinant Human MRPS10 Protein, GST-tagged | +Inquiry |
| MRPS10-8854H | Recombinant Human MRPS10 protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MRPS10-1134HCL | Recombinant Human MRPS10 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MRPS10 Products
Required fields are marked with *
My Review for All MRPS10 Products
Required fields are marked with *
