Recombinant Full Length Human MRPS11 Protein, GST-tagged
Cat.No. : | MRPS11-6455HF |
Product Overview : | Human MRPS11 full-length ORF ( NP_073750.2, 1 a.a. - 194 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 194 amino acids |
Description : | Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein that contains a high level of sequence similarity with ribosomal protein S11P family members. A pseudogene corresponding to this gene is found on chromosome 20. Sequence analysis identified two transcript variants that encode different protein isoforms. [provided by RefSeq |
Molecular Mass : | 47 kDa |
AA Sequence : | MQAVRNAGSRFLRSWTWPQTAGRVVARTPAGTICTGARQLQDAAAKQKVEQNAAPSHTKFSIYPPIPGEESSLRWAGKKFEEIPIAHIKASHNNTQIQVVSASNEPLAFASCGTEGFRNAKKGTGIAAQTAGIAAAARAKQKGVIHIRVVVKGLGPGRLSAMHGLIMGGLEVISITDNTPIPHNGCRPRKARKL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MRPS11 mitochondrial ribosomal protein S11 [ Homo sapiens ] |
Official Symbol | MRPS11 |
Synonyms | MRPS11; mitochondrial ribosomal protein S11; 28S ribosomal protein S11, mitochondrial; cervical cancer proto oncogene 2; FLJ22512; FLJ23406; HCC 2; S11mt; MRP-S11; cervical cancer proto-oncogene 2 protein; HCC-2; |
Gene ID | 64963 |
mRNA Refseq | NM_022839 |
Protein Refseq | NP_073750 |
MIM | 611977 |
UniProt ID | P82912 |
◆ Recombinant Proteins | ||
MRPS11-1261C | Recombinant Chicken MRPS11 | +Inquiry |
MRPS11-28172TH | Recombinant Human MRPS11, His-tagged | +Inquiry |
MRPS11-6455HF | Recombinant Full Length Human MRPS11 Protein, GST-tagged | +Inquiry |
MRPS11-2674R | Recombinant Rhesus Macaque MRPS11 Protein, His (Fc)-Avi-tagged | +Inquiry |
MRPS11-2854R | Recombinant Rhesus monkey MRPS11 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MRPS11-4153HCL | Recombinant Human MRPS11 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MRPS11 Products
Required fields are marked with *
My Review for All MRPS11 Products
Required fields are marked with *