Recombinant Full Length Human MRPS11 Protein, GST-tagged

Cat.No. : MRPS11-6455HF
Product Overview : Human MRPS11 full-length ORF ( NP_073750.2, 1 a.a. - 194 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 194 amino acids
Description : Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein that contains a high level of sequence similarity with ribosomal protein S11P family members. A pseudogene corresponding to this gene is found on chromosome 20. Sequence analysis identified two transcript variants that encode different protein isoforms. [provided by RefSeq
Molecular Mass : 47 kDa
AA Sequence : MQAVRNAGSRFLRSWTWPQTAGRVVARTPAGTICTGARQLQDAAAKQKVEQNAAPSHTKFSIYPPIPGEESSLRWAGKKFEEIPIAHIKASHNNTQIQVVSASNEPLAFASCGTEGFRNAKKGTGIAAQTAGIAAAARAKQKGVIHIRVVVKGLGPGRLSAMHGLIMGGLEVISITDNTPIPHNGCRPRKARKL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MRPS11 mitochondrial ribosomal protein S11 [ Homo sapiens ]
Official Symbol MRPS11
Synonyms MRPS11; mitochondrial ribosomal protein S11; 28S ribosomal protein S11, mitochondrial; cervical cancer proto oncogene 2; FLJ22512; FLJ23406; HCC 2; S11mt; MRP-S11; cervical cancer proto-oncogene 2 protein; HCC-2;
Gene ID 64963
mRNA Refseq NM_022839
Protein Refseq NP_073750
MIM 611977
UniProt ID P82912

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MRPS11 Products

Required fields are marked with *

My Review for All MRPS11 Products

Required fields are marked with *

0
cart-icon