Recombinant Full Length Human MRPS12 Protein, GST-tagged

Cat.No. : MRPS12-6458HF
Product Overview : Human MRPS12 full-length ORF ( AAH01617, 1 a.a. - 138 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 138 amino acids
Description : Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein that belongs to the ribosomal protein S12P family. The encoded protein is a key component of the ribosomal small subunit and controls the decoding fidelity and susceptibility to aminoglycoside antibiotics. The gene for mitochondrial seryl-tRNA synthetase is located upstream and adjacent to this gene, and both genes are possible candidates for the autosomal dominant deafness gene (DFNA4). Splice variants that differ in the 5 UTR have been found for this gene; all three variants encode the same protein. [provided by RefSeq
Molecular Mass : 40.92 kDa
AA Sequence : MSWSGLLHGLNTSLTCGPALVPRLWATCSMATLNQMHRLGPPKRPPRKLGPTEGRPQLKGVVLCTFTRKPKKPNSANRKCCRVRLSTGREAVCFIPGEGHTLQEHQIVLVEGGRTQDLPGVKLTVVRGKYDCGHVQKK
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MRPS12 mitochondrial ribosomal protein S12 [ Homo sapiens (human) ]
Official Symbol MRPS12
Synonyms MRPS12; mitochondrial ribosomal protein S12; RPS12; RPMS12; RPSM12; MPR-S12; MT-RPS12; 28S ribosomal protein S12, mitochondrial; MRP-S12; S12mt; mitochondrial small ribosomal subunit protein uS12m
Gene ID 6183
mRNA Refseq NM_021107
Protein Refseq NP_066930
MIM 603021
UniProt ID O15235

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MRPS12 Products

Required fields are marked with *

My Review for All MRPS12 Products

Required fields are marked with *

0
cart-icon
0
compare icon