Recombinant Full Length Human MRPS12 Protein, GST-tagged
Cat.No. : | MRPS12-6458HF |
Product Overview : | Human MRPS12 full-length ORF ( AAH01617, 1 a.a. - 138 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 138 amino acids |
Description : | Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein that belongs to the ribosomal protein S12P family. The encoded protein is a key component of the ribosomal small subunit and controls the decoding fidelity and susceptibility to aminoglycoside antibiotics. The gene for mitochondrial seryl-tRNA synthetase is located upstream and adjacent to this gene, and both genes are possible candidates for the autosomal dominant deafness gene (DFNA4). Splice variants that differ in the 5 UTR have been found for this gene; all three variants encode the same protein. [provided by RefSeq |
Molecular Mass : | 40.92 kDa |
AA Sequence : | MSWSGLLHGLNTSLTCGPALVPRLWATCSMATLNQMHRLGPPKRPPRKLGPTEGRPQLKGVVLCTFTRKPKKPNSANRKCCRVRLSTGREAVCFIPGEGHTLQEHQIVLVEGGRTQDLPGVKLTVVRGKYDCGHVQKK |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MRPS12 mitochondrial ribosomal protein S12 [ Homo sapiens (human) ] |
Official Symbol | MRPS12 |
Synonyms | MRPS12; mitochondrial ribosomal protein S12; RPS12; RPMS12; RPSM12; MPR-S12; MT-RPS12; 28S ribosomal protein S12, mitochondrial; MRP-S12; S12mt; mitochondrial small ribosomal subunit protein uS12m |
Gene ID | 6183 |
mRNA Refseq | NM_021107 |
Protein Refseq | NP_066930 |
MIM | 603021 |
UniProt ID | O15235 |
◆ Recombinant Proteins | ||
MRPS12-6458HF | Recombinant Full Length Human MRPS12 Protein, GST-tagged | +Inquiry |
MRPS12-5712M | Recombinant Mouse MRPS12 Protein, His (Fc)-Avi-tagged | +Inquiry |
MRPS12-1019H | Recombinant Human MRPS12, GST-tagged | +Inquiry |
MRPS12-10085M | Recombinant Mouse MRPS12 Protein | +Inquiry |
MRPS12-5601H | Recombinant Human MRPS12 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MRPS12-4152HCL | Recombinant Human MRPS12 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MRPS12 Products
Required fields are marked with *
My Review for All MRPS12 Products
Required fields are marked with *