Recombinant Full Length Human MRPS25 Protein, C-Flag-tagged
Cat.No. : | MRPS25-1047HFL |
Product Overview : | Recombinant Full Length Human MRPS25 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein. A pseudogene corresponding to this gene is found on chromosome 4. Alternative splicing results in multiple transcript variants. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 19.9 kDa |
AA Sequence : | MPMKGRFPIRRTLQYLSQGNVVFKDSVKVMTVNYNTHGELGEGARKFVFFNIPQIQYKNPWVQIMMFKNM TPSPFLRFYLDSGEQVLVDVETKSNKEIMEHIRKILGKNEETLREEEEEKKQLSHPANFGPRKYCLRECI CEVEGQVPCPSLVPLPKEMRGKYKAALKADAQDTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | MRPS25 mitochondrial ribosomal protein S25 [ Homo sapiens (human) ] |
Official Symbol | MRPS25 |
Synonyms | RPMS25; COXPD50; MRP-S25 |
Gene ID | 64432 |
mRNA Refseq | NM_022497.5 |
Protein Refseq | NP_071942.1 |
MIM | 611987 |
UniProt ID | P82663 |
◆ Recombinant Proteins | ||
MRPS25-262H | Recombinant Human mitochondrial ribosomal protein S25, His-tagged | +Inquiry |
MRPS25-3438R | Recombinant Rat MRPS25 Protein, His (Fc)-Avi-tagged | +Inquiry |
MRPS25-2862R | Recombinant Rhesus monkey MRPS25 Protein, His-tagged | +Inquiry |
Mrps25-4170M | Recombinant Mouse Mrps25 Protein, Myc/DDK-tagged | +Inquiry |
MRPS25-5721M | Recombinant Mouse MRPS25 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MRPS25-4141HCL | Recombinant Human MRPS25 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MRPS25 Products
Required fields are marked with *
My Review for All MRPS25 Products
Required fields are marked with *
0
Inquiry Basket