Recombinant Full Length Human MRPS30 Protein, GST-tagged
| Cat.No. : | MRPS30-6500HF |
| Product Overview : | Human MRPS30 full-length ORF ( AAH07735, 1 a.a. - 439 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 439 amino acids |
| Description : | Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein that is similar to the chicken pro-apoptotic protein p52. Transcript variants using alternative promoters or polyA sites have been mentioned in the literature but the complete description of these sequences is not available. [provided by RefSeq |
| Molecular Mass : | 74.03 kDa |
| AA Sequence : | MAAARCWRPLLRGPRLSLHTAANAAATATETTCQDVAATPVARYPPIVASMTADSKAARLRRIERWQATVHAAESVDEKLRILTKMQFMKYMVYPQTFALNADRWYQYFTKTVFLSGLPPPPAEPEPEPEPEPEPALDLAALRAVACDCLLQEHFYLRRRRRVHRYEESEVISLPFLDQLVSTLVGLLSPHNPALAAAALDYRCPVHFYWVRGEEIIPRGHRRGRIDDLRYQIDDKPNNQIRISKQLAEFVPLDYSVPIEIPTIKCKPDKLPLFKRQYENHIFVGSKTADPCCYGHTQFHLLPDKLRRERLLRQNCADQIEVVFRANAIASLFAWTGAQAMYQGFWSEADVTRPFVSQAVITDGKYFSFFCYQLNTLALTTQADQNNPRKNICWGTQSKPLYETIEDNDVKGFNDDVLLQIVHFLLNRPKEEKSQLLEN |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | MRPS30 mitochondrial ribosomal protein S30 [ Homo sapiens ] |
| Official Symbol | MRPS30 |
| Synonyms | MRPS30; mitochondrial ribosomal protein S30; PDCD9; 28S ribosomal protein S30, mitochondrial; PAP; programmed cell death 9; S30mt; MRP-S30; DKFZp566B2024; |
| Gene ID | 10884 |
| mRNA Refseq | NM_016640 |
| Protein Refseq | NP_057724 |
| MIM | 611991 |
| UniProt ID | Q9NP92 |
| ◆ Recombinant Proteins | ||
| MRPS30-1935H | Recombinant Human MRPS30 Protein, MYC/DDK-tagged | +Inquiry |
| MRPS30-1671HFL | Recombinant Full Length Human MRPS30 Protein, C-Flag-tagged | +Inquiry |
| MRPS30-1210H | Recombinant Human MRPS30 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| MRPS30-10100M | Recombinant Mouse MRPS30 Protein | +Inquiry |
| MRPS30-5523Z | Recombinant Zebrafish MRPS30 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MRPS30-1135HCL | Recombinant Human MRPS30 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MRPS30 Products
Required fields are marked with *
My Review for All MRPS30 Products
Required fields are marked with *
