Recombinant Full Length Human MRPS5 Protein, GST-tagged
Cat.No. : | MRPS5-6508HF |
Product Overview : | Human MRPS5 full-length ORF ( NP_114108.1, 1 a.a. - 430 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 430 amino acids |
Description : | Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein that belongs to the ribosomal protein S5P family. Pseudogenes corresponding to this gene are found on chromosomes 4q, 5q, and 18q. [provided by RefSeq |
Molecular Mass : | 74.4 kDa |
AA Sequence : | MATAVRAVGCLPVLCSGTAGHLLGRQCSLNTLPAASILAWKSVLGNGHLSSLGTRDTHPYASLSRALQTQCCISSPSHLMSQQYRPYSFFTKLTADELWKGALAETGAGAKKGRGKRTKKKKRKDLNRGQIIGEGRYGFLWPGLNVPLMKNGAVQTIAQRSKEEQEKVEADMIQQREEWDRKKKMKVKRERGWSGNSWGGISLGPPDPGPCGETYEDFDTRILEVRNVFTMTAKEGRKKSIRVLVAVGNGKGAAGFSIGKATDRMDAFRKAKNRAVHHLHYIERYEDHTIFHDISLRFKRTHIKMKKQPKGYGLRCHRAIITICRLIGIKDMYAKVSGSINMLSLTQGLFRGLSRQETHQQLADKKGLHVVEIREECGPLPIVVASPRGPLRKDPEPEDEVPDVKLDWEDVKTAQGMKRSVWSNLKRAAT |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MRPS5 mitochondrial ribosomal protein S5 [ Homo sapiens ] |
Official Symbol | MRPS5 |
Synonyms | MRPS5; mitochondrial ribosomal protein S5; 28S ribosomal protein S5, mitochondrial; mitochondrial 28S ribosomal protein S5; MRP S5; S5mt; MRP-S5; |
Gene ID | 64969 |
mRNA Refseq | NM_031902 |
Protein Refseq | NP_114108 |
MIM | 611972 |
UniProt ID | P82675 |
◆ Recombinant Proteins | ||
MRPS5-6508HF | Recombinant Full Length Human MRPS5 Protein, GST-tagged | +Inquiry |
MRPS5-1041H | Recombinant Human MRPS5, GST-tagged | +Inquiry |
MRPS5-4492Z | Recombinant Zebrafish MRPS5 | +Inquiry |
MRPS5-4268C | Recombinant Chicken MRPS5 | +Inquiry |
MRPS5-5624H | Recombinant Human MRPS5 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MRPS5-4133HCL | Recombinant Human MRPS5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MRPS5 Products
Required fields are marked with *
My Review for All MRPS5 Products
Required fields are marked with *