Recombinant Full Length Human MRPS7 Protein, C-Flag-tagged
Cat.No. : | MRPS7-1957HFL |
Product Overview : | Recombinant Full Length Human MRPS7 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein. In the prokaryotic ribosome, the comparable protein is thought to play an essential role in organizing the 3' domain of the 16 S rRNA in the vicinity of the P- and A-sites. Pseudogenes corresponding to this gene are found on chromosomes 8p and 12p. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 28 kDa |
AA Sequence : | MVAPAVKVARGWSGLALGVRRAVLQLPGLTQVRWSRYSPEFKDPLIDKEYYRKPVEELTEEEKYVRELKK TQLIKAAPAGKTSSVFEDPVISKFTNMMMIGGNKVLARSLMIQTLEAVKRKQFEKYHAASAEEQATIERN PYTIFHQALKNCEPMIGLVPILKGGRFYQVPVPLPDRRRRFLAMKWMITECRDKKHQRTLMPEKLSHKLL EAFHNQGPVIKRKHDLHKMAEANRALAHYRWW myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | MRPS7 mitochondrial ribosomal protein S7 [ Homo sapiens (human) ] |
Official Symbol | MRPS7 |
Synonyms | S7mt; MRP-S; RP-S7; RPMS7; MRP-S7; COXPD34; bMRP27a |
Gene ID | 51081 |
mRNA Refseq | NM_015971.4 |
Protein Refseq | NP_057055 |
MIM | 611974 |
UniProt ID | Q9Y2R9 |
◆ Recombinant Proteins | ||
MRPS7-3402Z | Recombinant Zebrafish MRPS7 | +Inquiry |
MRPS7-148H | Recombinant Human MRPS7, His-tagged | +Inquiry |
Mrps7-4175M | Recombinant Mouse Mrps7 Protein, Myc/DDK-tagged | +Inquiry |
MRPS7-5626H | Recombinant Human MRPS7 Protein, GST-tagged | +Inquiry |
MRPS7-3782R | Recombinant Rat MRPS7 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
MRPS7-4131HCL | Recombinant Human MRPS7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MRPS7 Products
Required fields are marked with *
My Review for All MRPS7 Products
Required fields are marked with *
0
Inquiry Basket