Recombinant Full Length Human MRS2 Protein, GST-tagged
Cat.No. : | MRS2-6513HF |
Product Overview : | Human MRS2L full-length ORF ( AAH01028, 1 a.a. - 117 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 117 amino acids |
Description : | MRS2 (MRS2, Magnesium Transporter) is a Protein Coding gene. Diseases associated with MRS2 include Basilar Artery Occlusion. Among its related pathways are Miscellaneous transport and binding events and Transport of glucose and other sugars, bile salts and organic acids, metal ions and amine compounds. GO annotations related to this gene include magnesium ion transmembrane transporter activity. |
Molecular Mass : | 38.61 kDa |
AA Sequence : | MECLRSLPCLLPRAMRLPRRTLCALALDVTSVGPPVAACGRRANLIGRSRAAQLCGPDRLRVAGEVHRFRTSDVSQATLASVAPVFTVTKFDKQGNVTSFVFESCDNSRVSSDIRLS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MRS2 MRS2 magnesium homeostasis factor homolog (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | MRS2 |
Synonyms | MRS2; MRS2 magnesium homeostasis factor homolog (S. cerevisiae); MRS2 like, magnesium homeostasis factor (S. cerevisiae) , MRS2L; magnesium transporter MRS2 homolog, mitochondrial; MRS2-like protein; MRS2-like, magnesium homeostasis factor; HPT; MRS2L; MGC78523; |
Gene ID | 57380 |
mRNA Refseq | NM_020662 |
Protein Refseq | NP_065713 |
MIM | 619307 |
UniProt ID | Q9HD23 |
◆ Cell & Tissue Lysates | ||
MRS2-67HCL | Recombinant Full Length Human MRS2 overexpression lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MRS2 Products
Required fields are marked with *
My Review for All MRS2 Products
Required fields are marked with *