Recombinant Full Length Human MS4A7 Protein, GST-tagged
| Cat.No. : | MS4A7-6551HF |
| Product Overview : | Human MS4A7 full-length ORF ( AAH20673, 1 a.a. - 240 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 240 amino acids |
| Description : | This gene encodes a member of the membrane-spanning 4A gene family, members of which are characterized by common structural features and similar intron/exon splice boundaries and display unique expression patterns in hematopoietic cells and nonlymphoid tissues. This family member is associated with mature cellular function in the monocytic lineage, and it may be a component of a receptor complex involved in signal transduction. This gene is localized to 11q12, in a cluster of other family members. At least four alternatively spliced transcript variants encoding two distinct isoforms have been observed. [provided by RefSeq |
| Molecular Mass : | 52.14 kDa |
| AA Sequence : | MLLQSQTMGVSHSFTPKGITIPQREKPGHMYQNEDYLQNGLPTETTVLGTVQILCCLLISSLGAILVFAPYPSHFNPAISTTLMSGYPFLGALCFGITGSLSIISGKQSTKPFDLSSLTSNAVSSVTAGAGLFLLADSMVALRTASQHCGSEMDYLSSLPYSEYYYPIYEIKDCLLTSVSLTGVLVVMLIFTVLELLLAAYSSVFWWKQLYSNNPGSSFSSTQSQDHIQQVKKSSSRSWI |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | MS4A7 membrane-spanning 4-domains, subfamily A, member 7 [ Homo sapiens ] |
| Official Symbol | MS4A7 |
| Synonyms | MS4A7; membrane-spanning 4-domains, subfamily A, member 7; membrane-spanning 4-domains subfamily A member 7; CD20L4; CFFM4; MS4A8; CD20 antigen-like 4; four-span transmembrane protein 2; CD20/Fc-epsilon-RI-beta family member 4; high affinity immunoglobulin epsilon receptor beta subunit; 4SPAN2; MGC22368; |
| Gene ID | 58475 |
| mRNA Refseq | NM_021201 |
| Protein Refseq | NP_067024 |
| MIM | 606502 |
| UniProt ID | Q9GZW8 |
| ◆ Recombinant Proteins | ||
| MS4A7-1053H | Recombinant Human MS4A7 protein, GST-tagged | +Inquiry |
| Ms4a7-410M | Recombinant Mouse Ms4a7 Protein, MYC/DDK-tagged | +Inquiry |
| MS4A7-3330H | Recombinant Human MS4A7 protein, His-tagged | +Inquiry |
| MS4A7-2692R | Recombinant Rhesus Macaque MS4A7 Protein, His (Fc)-Avi-tagged | +Inquiry |
| MS4A7-1937H | Recombinant Human MS4A7 Protein, MYC/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MS4A7-421HCL | Recombinant Human MS4A7 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MS4A7 Products
Required fields are marked with *
My Review for All MS4A7 Products
Required fields are marked with *
