Recombinant Full Length Human MSI2 Protein, C-Flag-tagged
Cat.No. : | MSI2-386HFL |
Product Overview : | Recombinant Full Length Human MSI2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes an RNA-binding protein that is a member of the Musashi protein family. The encoded protein is transcriptional regulator that targets genes involved in development and cell cycle regulation. Mutations in this gene are associated with poor prognosis in certain types of cancers. This gene has also been shown to be rearranged in certain cancer cells. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 35 kDa |
AA Sequence : | MEANGSQGTSGSANDSQHDPGKMFIGGLSWQTSPDSLRDYFSKFGEIRECMVMRDPTTKRSRGFGFVTFA DPASVDKVLGQPHHELDSKTIDPKVAFPRRAQPKMVTRTKKIFVGGLSANTVVEDVKQYFEQFGKVEDAM LMFDKTTNRHRGFGFVTFENEDVVEKVCEIHFHEINNKMVECKKAQPKEVMFPPGTRGRARGLPYTMDAF MLGMGMLGYPNFVATYGRGYPGFAPSYGYQFPGFPAAAYGPVAAAAVAAARGSGSNPARPGGFPGANSPG PVADLYGPASQDSGVGNYISAASPQPGSGFGHGIAGPLIATAFTNGYHSGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | MSI2 musashi RNA binding protein 2 [ Homo sapiens (human) ] |
Official Symbol | MSI2 |
Synonyms | MSI2H |
Gene ID | 124540 |
mRNA Refseq | NM_138962.4 |
Protein Refseq | NP_620412.1 |
MIM | 607897 |
UniProt ID | Q96DH6 |
◆ Recombinant Proteins | ||
MSI2-386HFL | Recombinant Full Length Human MSI2 Protein, C-Flag-tagged | +Inquiry |
Msi2-4189M | Recombinant Mouse Msi2 Protein, Myc/DDK-tagged | +Inquiry |
MSI2-225H | Recombinant Human musashi RNA-binding protein 2, His-tagged | +Inquiry |
MSI2-6562HF | Recombinant Full Length Human MSI2 Protein, GST-tagged | +Inquiry |
MSI2-5654H | Recombinant Human MSI2 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MSI2-4115HCL | Recombinant Human MSI2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MSI2 Products
Required fields are marked with *
My Review for All MSI2 Products
Required fields are marked with *
0
Inquiry Basket