Recombinant Full Length Human MSN Protein, C-Flag-tagged
Cat.No. : | MSN-317HFL |
Product Overview : | Recombinant Full Length Human MSN Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Moesin (for membrane-organizing extension spike protein) is a member of the ERM family which includes ezrin and radixin. ERM proteins appear to function as cross-linkers between plasma membranes and actin-based cytoskeletons. Moesin is localized to filopodia and other membranous protrusions that are important for cell-cell recognition and signaling and for cell movement. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 67.6 kDa |
AA Sequence : | MPKTISVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWFFGLQYQDTKGFSTWLKLNKKVTAQDV RKESPLLFKFRAKFYPEDVSEELIQDITQRLFFLQVKEGILNDDIYCPPETAVLLASYAVQSKYGDFNKE VHKSGYLAGDKLLPQRVLEQHKLNKDQWEERIQVWHEEHRGMLREDAVLEYLKIAQDLEMYGVNYFSIKN KKGSELWLGVDALGLNIYEQNDRLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRI LALCMGNHELYMRRRKPDTIEVQQMKAQAREEKHQKQMERAMLENEKKKREMAEKEKEKIEREKEELMER LKQIEEQTKKAQQELEEQTRRALELEQERKRAQSEAEKLAKERQEAEEAKEALLQASRDQKKTQEQLALE MAELTARISQLEMARQKKESEAVEWQQKAQMVQEDLEKTRAELKTAMSTPHVAEPAENEQDEQDENGAEA SADLRADAMAKDRSEEERTTEAEKNERVQKHLKALTSELANARDESKKTANDMIHAENMRLGRDKYKTLR QIRQGNTKQRIDEFESMTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Leukocyte transendothelial migration, Regulation of actin cytoskeleton |
Full Length : | Full L. |
Gene Name | MSN moesin [ Homo sapiens (human) ] |
Official Symbol | MSN |
Synonyms | HEL70; IMD50 |
Gene ID | 4478 |
mRNA Refseq | NM_002444.3 |
Protein Refseq | NP_002435.1 |
MIM | 309845 |
UniProt ID | P26038 |
◆ Recombinant Proteins | ||
MSN-28179TH | Recombinant Human MSN | +Inquiry |
MSN-3452R | Recombinant Rat MSN Protein, His (Fc)-Avi-tagged | +Inquiry |
Msn-4194M | Recombinant Mouse Msn Protein, Myc/DDK-tagged | +Inquiry |
MSN-317HFL | Recombinant Full Length Human MSN Protein, C-Flag-tagged | +Inquiry |
MSN-4608H | Recombinant Human MSN Protein (Ile354-Met577), N-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MSN-4110HCL | Recombinant Human MSN 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MSN Products
Required fields are marked with *
My Review for All MSN Products
Required fields are marked with *
0
Inquiry Basket