Recombinant Full Length Human MSRA Protein, GST-tagged
Cat.No. : | MSRA-6468HF |
Product Overview : | Human MSRA full-length ORF ( NP_036463.1, 1 a.a. - 235 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 235 amino acids |
Description : | This protein is ubiquitous and highly conserved. It carries out the enzymatic reduction of methionine sulfoxide to methionine. Human and animal studies have shown the highest levels of expression in kidney and nervous tissue. Its proposed function is the repair of oxidative damage to proteins to restore biological activity. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq |
Molecular Mass : | 52.5 kDa |
AA Sequence : | MLSATRRACQLLLLHSLFPVPRMGNSASNIVSPQEALPGRKEQTPVAAKHHVNGNRTVEPFPEGTQMAVFGMGCFWGAERKFWVLKGVYSTQVGFAGGYTSNPTYKEVCSEKTGHAEVVRVVYQPEHMSFEELLKVFWENHDPTQGMRQGNDHGTQYRSAIYPTSAKQMEAALSSKENYQKVLSEHGFGPITTDIREGQTFYYAEDYHQQYLSKNPNGYCGLGGTGVSCPVGIKK |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MSRA methionine sulfoxide reductase A [ Homo sapiens ] |
Official Symbol | MSRA |
Synonyms | MSRA; methionine sulfoxide reductase A; mitochondrial peptide methionine sulfoxide reductase; peptide Met(O) reductase; peptide met (O) reductase; protein-methionine-S-oxide reductase; peptide methionine sulfoxide reductase; peptide-methionine (S)-S-oxide reductase; cytosolic methionine-S-sulfoxide reductase; PMSR; |
Gene ID | 4482 |
mRNA Refseq | NM_001135670 |
Protein Refseq | NP_001129142 |
MIM | 601250 |
UniProt ID | Q9UJ68 |
◆ Recombinant Proteins | ||
MSRA-1019H | Recombinant Human MSRA | +Inquiry |
msrA-988E | Recombinant E.coli MsrA, His-tagged | +Inquiry |
MSRA-3794R | Recombinant Rat MSRA Protein | +Inquiry |
MSRA-4235H | Recombinant Human MSRA Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
MSRA-0535B | Recombinant Bacillus subtilis MSRA protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MSRA-4109HCL | Recombinant Human MSRA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MSRA Products
Required fields are marked with *
My Review for All MSRA Products
Required fields are marked with *
0
Inquiry Basket