Recombinant Full Length Human MSX1 Protein, GST-tagged

Cat.No. : MSX1-6476HF
Product Overview : Human MSX1 full-length ORF ( AAH67353.1, 1 a.a. - 297 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 297 amino acids
Description : This gene encodes a member of the muscle segment homeobox gene family. The encoded protein functions as a transcriptional repressor during embryogenesis through interactions with components of the core transcription complex and other homeoproteins. It may also have roles in limb-pattern formation, craniofacial development, particularly odontogenesis, and tumor growth inhibition. Mutations in this gene, which was once known as homeobox 7, have been associated with nonsyndromic cleft lip with or without cleft palate 5, Witkop syndrome, Wolf-Hirschom syndrome, and autosomoal dominant hypodontia. [provided by RefSeq
Molecular Mass : 57.3 kDa
AA Sequence : MTSLPLGVKVEDSAFGKPAGGGAGQAPSAAAATAAAMGADEEGAKPKVSPSLLPFSVEALMADHRKPGAKESALAPSEGVQAAGGSAQPLGVPPGSLGAPDAPSSPRPLGHFSVGGLLKLPEDALVKAESPEKPERTPWMQSPRFSPPPARRLSPPACTLRKHKTNRKPRTPFTTAQLLALERKFRQKQYLSIAERAEFSSSLSLTETQVKIWFQNRRAKAKRLQEAELEKLKMAAKPMLPPAAFGLSFPLGGPAAVAAAAGASLYGASGPFQRAALPVAPVGLYTAHVGYSMYHLT
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MSX1 msh homeobox 1 [ Homo sapiens ]
Official Symbol MSX1
Synonyms MSX1; msh homeobox 1; HOX7, msh (Drosophila) homeo box homolog 1 (formerly homeo box 7) , msh homeobox homolog 1 (Drosophila); homeobox protein MSX-1; HYD1; OFC5; homeobox 7; msh homeo box 1; homeobox protein Hox-7; msh homeobox homolog 1; msh homeobox 1-like protein; HOX7; STHAG1;
Gene ID 4487
mRNA Refseq NM_002448
Protein Refseq NP_002439
MIM 142983
UniProt ID P28360

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MSX1 Products

Required fields are marked with *

My Review for All MSX1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon