Recombinant Full Length Human MSX1 Protein, GST-tagged
Cat.No. : | MSX1-6476HF |
Product Overview : | Human MSX1 full-length ORF ( AAH67353.1, 1 a.a. - 297 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 297 amino acids |
Description : | This gene encodes a member of the muscle segment homeobox gene family. The encoded protein functions as a transcriptional repressor during embryogenesis through interactions with components of the core transcription complex and other homeoproteins. It may also have roles in limb-pattern formation, craniofacial development, particularly odontogenesis, and tumor growth inhibition. Mutations in this gene, which was once known as homeobox 7, have been associated with nonsyndromic cleft lip with or without cleft palate 5, Witkop syndrome, Wolf-Hirschom syndrome, and autosomoal dominant hypodontia. [provided by RefSeq |
Molecular Mass : | 57.3 kDa |
AA Sequence : | MTSLPLGVKVEDSAFGKPAGGGAGQAPSAAAATAAAMGADEEGAKPKVSPSLLPFSVEALMADHRKPGAKESALAPSEGVQAAGGSAQPLGVPPGSLGAPDAPSSPRPLGHFSVGGLLKLPEDALVKAESPEKPERTPWMQSPRFSPPPARRLSPPACTLRKHKTNRKPRTPFTTAQLLALERKFRQKQYLSIAERAEFSSSLSLTETQVKIWFQNRRAKAKRLQEAELEKLKMAAKPMLPPAAFGLSFPLGGPAAVAAAAGASLYGASGPFQRAALPVAPVGLYTAHVGYSMYHLT |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MSX1 msh homeobox 1 [ Homo sapiens ] |
Official Symbol | MSX1 |
Synonyms | MSX1; msh homeobox 1; HOX7, msh (Drosophila) homeo box homolog 1 (formerly homeo box 7) , msh homeobox homolog 1 (Drosophila); homeobox protein MSX-1; HYD1; OFC5; homeobox 7; msh homeo box 1; homeobox protein Hox-7; msh homeobox homolog 1; msh homeobox 1-like protein; HOX7; STHAG1; |
Gene ID | 4487 |
mRNA Refseq | NM_002448 |
Protein Refseq | NP_002439 |
MIM | 142983 |
UniProt ID | P28360 |
◆ Recombinant Proteins | ||
MSX1-5757M | Recombinant Mouse MSX1 Protein, His (Fc)-Avi-tagged | +Inquiry |
MSX1-2881R | Recombinant Rhesus monkey MSX1 Protein, His-tagged | +Inquiry |
MSX1-10154M | Recombinant Mouse MSX1 Protein | +Inquiry |
MSX1-7037C | Recombinant Chicken MSX1 | +Inquiry |
MSX1-6476HF | Recombinant Full Length Human MSX1 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MSX1-4105HCL | Recombinant Human MSX1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MSX1 Products
Required fields are marked with *
My Review for All MSX1 Products
Required fields are marked with *