Recombinant Full Length Human MSX2 Protein, C-Flag-tagged
Cat.No. : | MSX2-2062HFL |
Product Overview : | Recombinant Full Length Human MSX2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the muscle segment homeobox gene family. The encoded protein is a transcriptional repressor whose normal activity may establish a balance between survival and apoptosis of neural crest-derived cells required for proper craniofacial morphogenesis. The encoded protein may also have a role in promoting cell growth under certain conditions and may be an important target for the RAS signaling pathways. Mutations in this gene are associated with parietal foramina 1 and craniosynostosis type 2. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 28.7 kDa |
AA Sequence : | MASPSKGNDLFSPDEEGPAVVAGPGPGPGGAEGAAEERRVKVSSLPFSVEALMSDKKPPKEASPLPAESA SAGATLRPLLLSGHGAREAHSPGPLVKPFETASVKSENSEDGAAWMQEPGRYSPPPRHTSPTTCTLRKHK TNRKPRTPFTTSQLLALERKFRQKQYLSIAERAEFSSSLNLTETQVKIWFQNRRAKAKRLQEAELEKLKM AAKPMLPSSFSLPFPISSPLQAASIYGASYPFHRPVLPIPPVGLYATPVGYGMYHLS myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Transcription Factors |
Full Length : | Full L. |
Gene Name | MSX2 msh homeobox 2 [ Homo sapiens (human) ] |
Official Symbol | MSX2 |
Synonyms | FPP; MSH; PFM; CRS2; HOX8; PFM1 |
Gene ID | 4488 |
mRNA Refseq | NM_002449.5 |
Protein Refseq | NP_002440.2 |
MIM | 123101 |
UniProt ID | P35548 |
◆ Recombinant Proteins | ||
MSX2-6477HF | Recombinant Full Length Human MSX2 Protein, GST-tagged | +Inquiry |
MSX2-301218H | Recombinant Human MSX2 protein, GST-tagged | +Inquiry |
MSX2-1444H | Recombinant Human MSX2 Protein, His (Fc)-Avi-tagged | +Inquiry |
MSX2-10155M | Recombinant Mouse MSX2 Protein | +Inquiry |
MSX2-5758M | Recombinant Mouse MSX2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MSX2-1141HCL | Recombinant Human MSX2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MSX2 Products
Required fields are marked with *
My Review for All MSX2 Products
Required fields are marked with *
0
Inquiry Basket