Recombinant Full Length Human MT1E Protein, GST-tagged

• Cat.No.: MT1E-6988HF
• Product Overview: Recombinant Human full-length MT1E(1 a.a. - 61 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 61 amino acids
• Description: Metallothionein-1E is a protein that in humans is encoded by the MT1E gene.
• Molecular Mass: 32.45 kDa
• AA Sequence: MDPNCSCATGGSCTCAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCVCKGASEKCSCCA
• Applications: ELISA; WB-Re; AP; Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MT1E metallothionein 1E [ Homo sapiens (human) ]
• Official Symbol: MT1E
• Synonyms: MT1E; MT1; MTD; metallothionein 1E; metallothionein-1E; MT-1E; MT-IE; metallothionein D; metallothionein-IE; metallothionein 1E (functional)
• Gene ID: 4493
• mRNA Refseq: NM_175617
• Protein Refseq: NP_783316
• MIM: 156351
• UniProt ID: P04732