Recombinant Full Length Human MT1E Protein, GST-tagged
Cat.No. : | MT1E-6988HF |
Product Overview : | Recombinant Human full-length MT1E(1 a.a. - 61 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 61 amino acids |
Description : | Metallothionein-1E is a protein that in humans is encoded by the MT1E gene. |
Molecular Mass : | 32.45 kDa |
AA Sequence : | MDPNCSCATGGSCTCAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCVCKGASEKCSCCA |
Applications : | ELISA; WB-Re; AP; Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MT1E metallothionein 1E [ Homo sapiens (human) ] |
Official Symbol | MT1E |
Synonyms | MT1E; MT1; MTD; metallothionein 1E; metallothionein-1E; MT-1E; MT-IE; metallothionein D; metallothionein-IE; metallothionein 1E (functional) |
Gene ID | 4493 |
mRNA Refseq | NM_175617 |
Protein Refseq | NP_783316 |
MIM | 156351 |
UniProt ID | P04732 |
◆ Recombinant Proteins | ||
MT1E-661H | Recombinant Human MT1E Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
MT1E-2704R | Recombinant Rhesus Macaque MT1E Protein, His (Fc)-Avi-tagged | +Inquiry |
MT1E-2884R | Recombinant Rhesus monkey MT1E Protein, His-tagged | +Inquiry |
MT1E-8242H | Recombinant Human MT1E protein, His & GST-tagged | +Inquiry |
MT1E-1445H | Recombinant Human MT1E Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MT1E Products
Required fields are marked with *
My Review for All MT1E Products
Required fields are marked with *
0
Inquiry Basket