Recombinant Full Length Human MT3 Protein, GST-tagged

Cat.No. : MT3-7002HF
Product Overview : Recombinant Human full-length MT3(1 a.a. - 68 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 68 amino acids
Description : Metallothionein-3 is a protein that in humans is encoded by the MT3 gene.
Molecular Mass : 33.11 kDa
AA Sequence : MDPETCPCPSGGSCTCADSCKCEGCKCTSCKKSCCSCCPAECEKCAKDCVCKGGEAAEAEAEKCSCCQ
Applications : ELISA; WB-Re; AP; Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MT3 metallothionein 3 [ Homo sapiens (human) ]
Official Symbol MT3
Synonyms MT3; metallothionein 3; metallothionein 3 (growth inhibitory factor (neurotrophic)); metallothionein-3; GIF; MT-3; MT-III; metallothionein-III; growth inhibitory factor; GIFB; GRIF; ZnMT3
Gene ID 4504
mRNA Refseq NM_005954
Protein Refseq NP_005945
MIM 139255
UniProt ID P25713

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MT3 Products

Required fields are marked with *

My Review for All MT3 Products

Required fields are marked with *

0
cart-icon