Recombinant Full Length Human MT3 Protein, GST-tagged

• Cat.No.: MT3-7002HF
• Product Overview: Recombinant Human full-length MT3(1 a.a. - 68 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 68 amino acids
• Description: Metallothionein-3 is a protein that in humans is encoded by the MT3 gene.
• Molecular Mass: 33.11 kDa
• AA Sequence: MDPETCPCPSGGSCTCADSCKCEGCKCTSCKKSCCSCCPAECEKCAKDCVCKGGEAAEAEAEKCSCCQ
• Applications: ELISA; WB-Re; AP; Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MT3 metallothionein 3 [ Homo sapiens (human) ]
• Official Symbol: MT3
• Synonyms: MT3; metallothionein 3; metallothionein 3 (growth inhibitory factor (neurotrophic)); metallothionein-3; GIF; MT-3; MT-III; metallothionein-III; growth inhibitory factor; GIFB; GRIF; ZnMT3
• Gene ID: 4504
• mRNA Refseq: NM_005954
• Protein Refseq: NP_005945
• MIM: 139255
• UniProt ID: P25713