Recombinant Full Length Human MTERF Protein, GST-tagged
| Cat.No. : | MTERF-6488HF |
| Product Overview : | Human MTERF full-length ORF ( AAH00965, 1 a.a. - 399 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 399 amino acids |
| Description : | This gene encodes a mitochondrial transcription termination factor. This protein participates in attenuating transcription from the mitochondrial genome; this attenuation allows higher levels of expression of 16S ribosomal RNA relative to the tRNA gene downstream. The product of this gene has three leucine zipper motifs bracketed by two basic domains that are all required for DNA binding. There is evidence that, for this protein, the zippers participate in intramolecular interactions that establish the three-dimensional structure required for DNA binding. [provided by RefSeq |
| Molecular Mass : | 69.63 kDa |
| AA Sequence : | MQSLSLGQTSISKGLNYLTIMAPGNLWHMRNNFLFGSRCWMTRFSAENIFKSVSFRLFGVKCHNTDSEPLKNEDLLKNLLTMGVDIDMARKRQPGVFHRMITNEQDLKMFLLSKGASKEVIASIISRYPRAITRTPENLSKRWDLWRKIVTSDLEIVNILERSPESFFRSNNNLNLENNIKFLYSVGLTRKCLCRLLTNAPRTFSNSLDLNKQMVEFLQAAGLSLGHNDPTDFVRKIIFKNPFILIQSTKRVKANIEFLRSTFNLNSEELLVLICGPGAEILDLSNDYARRSYANIKEKLFSLGCTEEEVQKFVLSYPDVIFLAEKKFNDEIDCLMEENISISQIIENPRVLDSSISTLKSRIKELVNAGCNLSTLNITLLSWSKKRYEAKLKKLSRFA |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | MTERF mitochondrial transcription termination factor [ Homo sapiens ] |
| Official Symbol | MTERF |
| Synonyms | MTERF; mitochondrial transcription termination factor; transcription termination factor, mitochondrial; mitochondrial transcription termination factor 1; MGC131634; |
| Gene ID | 7978 |
| mRNA Refseq | NM_006980 |
| Protein Refseq | NP_008911 |
| MIM | 602318 |
| UniProt ID | Q99551 |
| ◆ Recombinant Proteins | ||
| MTERF-3462R | Recombinant Rat MTERF Protein, His (Fc)-Avi-tagged | +Inquiry |
| MTERF-6488HF | Recombinant Full Length Human MTERF Protein, GST-tagged | +Inquiry |
| MTERF-5771M | Recombinant Mouse MTERF Protein, His (Fc)-Avi-tagged | +Inquiry |
| MTERF-3803R | Recombinant Rat MTERF Protein | +Inquiry |
| MTERF-5691H | Recombinant Human MTERF Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MTERF-4088HCL | Recombinant Human MTERF 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MTERF Products
Required fields are marked with *
My Review for All MTERF Products
Required fields are marked with *
