Recombinant Full Length Human MTF2 Protein, GST-tagged

Cat.No. : MTF2-6498HF
Product Overview : Human MTF2 full-length ORF ( AAH10013.1, 1 a.a. - 536 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 536 amino acids
Description : MTF2 (Metal Response Element Binding Transcription Factor 2) is a Protein Coding gene. Among its related pathways are Mesodermal Commitment Pathway and Interactome of polycomb repressive complex 2 (PRC2). GO annotations related to this gene include methylated histone binding. An important paralog of this gene is PHF19.
Molecular Mass : 84.7 kDa
AA Sequence : MRDSTGAGNSLVHKRSPLRRNQKTPTSLTKLSLQDGHKAKKPACKFEEGQDVLARWSDGLFYLGTIKKINILKQSCFIIFEDSSKSWVLWKDIQTGATGSGEMVCTICQEEYSEAPNEMVICDKCGQGYHQLCHTPHIDSSVIDSDEKWLCRQCVFATTTKRGGALKKGPNAKALQVMKQTLPYSVADLEWDAGHKTNVQQCYCYCGGPGDWYLKMLQCCKCKQWFHEACVQCLQKPMLFGDRFYTFICSVCSSGPEYLKRLPLQWVDIAHLCLYNLSVIHKKKYFDSELELMTYINENWDRLHPGELADTPKSERYEHVLEALNDYKTMEVSNGIEKKGKKKSVGRPPGPYTRKMIQKTAEPLLDKESISENPTLDLPCSIGRTEGTAHSSNTSDVDFTGASSAKETTSSSISRHYGLSDSRKRTRTGRSWPAAIPHLRRRRGRLPRRALQTQNSEIVKDDEGKEDYQFDELNTEILNNLADQELQLNHLKNSITSYFGAAGRIACGEKYRVLARRVTLDGKVQYLVEWEGATAS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MTF2 metal response element binding transcription factor 2 [ Homo sapiens ]
Official Symbol MTF2
Synonyms MTF2; metal response element binding transcription factor 2; metal-response element-binding transcription factor 2; M96; PCL2; polycomb like 2; hPCl2; polycomb-like 2; polycomb-like protein 2; putative DNA binding protein; metal regulatory transcription factor 2; metal-response element DNA-binding protein M96; metal response element-binding transcription factor 2; dJ976O13.2; RP5-976O13.1;
Gene ID 22823
mRNA Refseq NM_001164391
Protein Refseq NP_001157863
MIM 609882
UniProt ID Q9Y483

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MTF2 Products

Required fields are marked with *

My Review for All MTF2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon