Recombinant Full Length Human MTF2 Protein, GST-tagged
Cat.No. : | MTF2-6498HF |
Product Overview : | Human MTF2 full-length ORF ( AAH10013.1, 1 a.a. - 536 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 536 amino acids |
Description : | MTF2 (Metal Response Element Binding Transcription Factor 2) is a Protein Coding gene. Among its related pathways are Mesodermal Commitment Pathway and Interactome of polycomb repressive complex 2 (PRC2). GO annotations related to this gene include methylated histone binding. An important paralog of this gene is PHF19. |
Molecular Mass : | 84.7 kDa |
AA Sequence : | MRDSTGAGNSLVHKRSPLRRNQKTPTSLTKLSLQDGHKAKKPACKFEEGQDVLARWSDGLFYLGTIKKINILKQSCFIIFEDSSKSWVLWKDIQTGATGSGEMVCTICQEEYSEAPNEMVICDKCGQGYHQLCHTPHIDSSVIDSDEKWLCRQCVFATTTKRGGALKKGPNAKALQVMKQTLPYSVADLEWDAGHKTNVQQCYCYCGGPGDWYLKMLQCCKCKQWFHEACVQCLQKPMLFGDRFYTFICSVCSSGPEYLKRLPLQWVDIAHLCLYNLSVIHKKKYFDSELELMTYINENWDRLHPGELADTPKSERYEHVLEALNDYKTMEVSNGIEKKGKKKSVGRPPGPYTRKMIQKTAEPLLDKESISENPTLDLPCSIGRTEGTAHSSNTSDVDFTGASSAKETTSSSISRHYGLSDSRKRTRTGRSWPAAIPHLRRRRGRLPRRALQTQNSEIVKDDEGKEDYQFDELNTEILNNLADQELQLNHLKNSITSYFGAAGRIACGEKYRVLARRVTLDGKVQYLVEWEGATAS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MTF2 metal response element binding transcription factor 2 [ Homo sapiens ] |
Official Symbol | MTF2 |
Synonyms | MTF2; metal response element binding transcription factor 2; metal-response element-binding transcription factor 2; M96; PCL2; polycomb like 2; hPCl2; polycomb-like 2; polycomb-like protein 2; putative DNA binding protein; metal regulatory transcription factor 2; metal-response element DNA-binding protein M96; metal response element-binding transcription factor 2; dJ976O13.2; RP5-976O13.1; |
Gene ID | 22823 |
mRNA Refseq | NM_001164391 |
Protein Refseq | NP_001157863 |
MIM | 609882 |
UniProt ID | Q9Y483 |
◆ Recombinant Proteins | ||
MTF2-1079H | Recombinant Human MTF2, GST-tagged | +Inquiry |
MTF2-5698H | Recombinant Human MTF2 Protein, GST-tagged | +Inquiry |
MTF2-6077C | Recombinant Chicken MTF2 | +Inquiry |
MTF2-5776M | Recombinant Mouse MTF2 Protein, His (Fc)-Avi-tagged | +Inquiry |
MTF2-6498HF | Recombinant Full Length Human MTF2 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MTF2-1143HCL | Recombinant Human MTF2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MTF2 Products
Required fields are marked with *
My Review for All MTF2 Products
Required fields are marked with *