Recombinant Full Length Human MYBL2 Protein, C-Flag-tagged
Cat.No. : | MYBL2-1690HFL |
Product Overview : | Recombinant Full Length Human MYBL2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene, a member of the MYB family of transcription factor genes, is a nuclear protein involved in cell cycle progression. The encoded protein is phosphorylated by cyclin A/cyclin-dependent kinase 2 during the S-phase of the cell cycle and possesses both activator and repressor activities. It has been shown to activate the cell division cycle 2, cyclin D1, and insulin-like growth factor-binding protein 5 genes. Two transcript variants encoding different isoforms have been found for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 78.6 kDa |
AA Sequence : | MSRRTRCEDLDELHYQDTDSDVPEQRDSKCKVKWTHEEDEQLRALVRQFGQQDWKFLASHFPNRTDQQCQ YRWLRVLNPDLVKGPWTKEEDQKVIELVKKYGTKQWTLIAKHLKGRLGKQCRERWHNHLNPEVKKSCWTE EEDRIICEAHKVLGNRWAEIAKMLPGRTDNAVKNHWNSTIKRKVDTGGFLSESKDCKPPVYLLLELEDKD GLQSAQPTEGQGSLLTNWPSVPPTIKEEENSEEELAAATTSKEQEPIGTDLDAVRTPEPLEEFPKREDQE GSPPETSLPYKWVVEAANLLIPAVGSSLSEALDLIESDPDAWCDLSKFDLPEEPSAEDSINNSLVQLQAS HQQQVLPPRQPSALVPSVTEYRLDGHTISDLSRSSRGELIPISPSTEVGGSGIGTPPSVLKRQRKRRVAL SPVTENSTSLSFLDSCNSLTPKSTPVKTLPFSPSQFLNFWNKQDTLELESPSLTSTPVCSQKVVVTTPLH RDKTPLHQKHAAFVTPDQKYSMDNTPHTPTPFKNALEKYGPLKPLPQTPHLEEDLKEVLRSEAGIELIIE DDIRPEKQKRKPGLRRSPIKKVRKSLALDIVDEDVKLMMSTLPKSLSLPTTAPSNSSSLTLSGIKEDNSL LNQGFLQAKPEKAAVAQKPRSHFTTPAPMSSAWKTVACGGTRDQLFMQEKARQLLGRLKPSHTSRTLILSTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Stem cell - Pluripotency, Transcription Factors |
Full Length : | Full L. |
Gene Name | MYBL2 MYB proto-oncogene like 2 [ Homo sapiens (human) ] |
Official Symbol | MYBL2 |
Synonyms | BMYB; B-MYB |
Gene ID | 4605 |
mRNA Refseq | NM_002466.4 |
Protein Refseq | NP_002457.1 |
MIM | 601415 |
UniProt ID | P10244 |
◆ Recombinant Proteins | ||
MYBL2-1460H | Recombinant Human MYBL2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Mybl2-4234M | Recombinant Mouse Mybl2 Protein, Myc/DDK-tagged | +Inquiry |
MYBL2-2734R | Recombinant Rhesus Macaque MYBL2 Protein, His (Fc)-Avi-tagged | +Inquiry |
MYBL2-1690HFL | Recombinant Full Length Human MYBL2 Protein, C-Flag-tagged | +Inquiry |
MYBL2-6870C | Recombinant Chicken MYBL2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
MYBL2-4043HCL | Recombinant Human MYBL2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MYBL2 Products
Required fields are marked with *
My Review for All MYBL2 Products
Required fields are marked with *
0
Inquiry Basket