Recombinant Full Length Human MYD88 Protein, GST-tagged
Cat.No. : | MYD88-6731HF |
Product Overview : | Human MYD88 full-length ORF ( AAH13589.1, 1 a.a. - 296 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 296 amino acids |
Description : | This gene encodes a cytosolic adapter protein that plays a central role in the innate and adaptive immune response. This protein functions as an essential signal transducer in the interleukin-1 and Toll-like receptor signaling pathways. These pathways regulate that activation of numerous proinflammatory genes. The encoded protein consists of an N-terminal death domain and a C-terminal Toll-interleukin1 receptor domain. Patients with defects in this gene have an increased susceptibility to pyogenic bacterial infections. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Feb 2010] |
Molecular Mass : | 58.3 kDa |
AA Sequence : | MAAGGPGAGSAAPVSSTSSLPLAALNMRVRRRLSLFLNVRTQVAADWTALAEEMDFEYLEIRQLETQADPTGRLLDAWQGRPGASVGRLLELLTKLGRDDVLLELGPSIEEDCQKYILKQQQEEAEKPLQVAAVDSSVPRTAELAGITTLDDPLGHMPERFDAFICYCPSDIQFVQEMIRQLEQTNYRLKLCVSDRDVLPGTCVWSIASELIEKRCRRMVVVVSDDYLQSKECDFQTKFALSLSPGAHQKRLIPIKYKAMKKEFPSILRSITVCDYTNPCTKSWFWTRLAKALSLP |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MYD88 myeloid differentiation primary response gene (88) [ Homo sapiens ] |
Official Symbol | MYD88 |
Synonyms | MYD88; myeloid differentiation primary response gene (88); myeloid differentiation primary response protein MyD88; MYD88D; |
Gene ID | 4615 |
mRNA Refseq | NM_001172566 |
Protein Refseq | NP_001166037 |
MIM | 602170 |
UniProt ID | Q99836 |
◆ Recombinant Proteins | ||
MYD88-1462H | Recombinant Human MYD88 Protein, His (Fc)-Avi-tagged | +Inquiry |
MYD88-2650C | Recombinant Chicken MYD88 | +Inquiry |
MYD88-1550H | Recombinant Human Myeloid Differentiation Primary Response Gene (88) | +Inquiry |
MYD88-687HFL | Recombinant Full Length Human MYD88 Protein, C-Flag-tagged | +Inquiry |
Myd88-4241M | Recombinant Mouse Myd88 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MYD88-4034HCL | Recombinant Human MYD88 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MYD88 Products
Required fields are marked with *
My Review for All MYD88 Products
Required fields are marked with *