Recombinant Full Length Human MYDGF Protein, C-Flag-tagged
| Cat.No. : | MYDGF-1072HFL |
| Product Overview : | Recombinant Full Length Human MYDGF Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Mammalian Cells |
| Tag : | Flag |
| Description : | The protein encoded by this gene was previously thought to support proliferation of lymphoid cells and was considered an interleukin. However, this activity has not been reproducible and the function of this protein is currently unknown. |
| Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
| Molecular Mass : | 18.6 kDa |
| AA Sequence : | MAAPSGGWNGVGASLWAALLLGAVALRPAEAVSEPTTVAFDVRPGGVVHSFSHNVGPGDKYTCMFTYASQ GGTNEQWQMSLGTSEDHQHFTCTIWRPQGKSYLYFTQFKAEVRGAEIEYAMAYSKAAFERESDVPLKTEE FEVTKTAVAHRPGAFKAELSKLVIVAKASRTELTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
| Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Storage : | Store at -80 centigrade. |
| Concentration : | >50 ug/mL as determined by microplate BCA method. |
| Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Protein Families : | Secreted Protein |
| Full Length : | Full L. |
| Gene Name | MYDGF myeloid derived growth factor [ Homo sapiens (human) ] |
| Official Symbol | MYDGF |
| Synonyms | IL25; IL27; SF20; IL27w; C19orf10; R33729_1; EUROIMAGE1875335 |
| Gene ID | 56005 |
| mRNA Refseq | NM_019107.4 |
| Protein Refseq | NP_061980.1 |
| MIM | 606746 |
| UniProt ID | Q969H8 |
| ◆ Recombinant Proteins | ||
| MYDGF-1072HFL | Recombinant Full Length Human MYDGF Protein, C-Flag-tagged | +Inquiry |
| Mydgf-01M | Recombinant Mouse Mydgf Protein | +Inquiry |
| MYDGF-1463H | Recombinant Human MYDGF Protein, His (Fc)-Avi-tagged | +Inquiry |
| MYDGF-537H | Recombinant Human MYDGF Protein, Fc-tagged | +Inquiry |
| MYDGF-2332H | Recombinant Human MYDGF Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MYDGF Products
Required fields are marked with *
My Review for All MYDGF Products
Required fields are marked with *
