Recombinant Full Length Human MYDGF Protein, C-Flag-tagged

Cat.No. : MYDGF-1072HFL
Product Overview : Recombinant Full Length Human MYDGF Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Mammalian Cells
Tag : Flag
Description : The protein encoded by this gene was previously thought to support proliferation of lymphoid cells and was considered an interleukin. However, this activity has not been reproducible and the function of this protein is currently unknown.
Form : 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
Molecular Mass : 18.6 kDa
AA Sequence : MAAPSGGWNGVGASLWAALLLGAVALRPAEAVSEPTTVAFDVRPGGVVHSFSHNVGPGDKYTCMFTYASQ GGTNEQWQMSLGTSEDHQHFTCTIWRPQGKSYLYFTQFKAEVRGAEIEYAMAYSKAAFERESDVPLKTEE
FEVTKTAVAHRPGAFKAELSKLVIVAKASRTELTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining.
Stability : Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Storage : Store at -80 centigrade.
Concentration : >50 ug/mL as determined by microplate BCA method.
Preparation : Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Protein Families : Secreted Protein
Full Length : Full L.
Gene Name MYDGF myeloid derived growth factor [ Homo sapiens (human) ]
Official Symbol MYDGF
Synonyms IL25; IL27; SF20; IL27w; C19orf10; R33729_1; EUROIMAGE1875335
Gene ID 56005
mRNA Refseq NM_019107.4
Protein Refseq NP_061980.1
MIM 606746
UniProt ID Q969H8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MYDGF Products

Required fields are marked with *

My Review for All MYDGF Products

Required fields are marked with *

0
cart-icon
0
compare icon