Recombinant Full Length Human Myelin Protein Zero-Like Protein 3(Mpzl3) Protein, His-Tagged
| Cat.No. : | RFL11623HF |
| Product Overview : | Recombinant Full Length Human Myelin protein zero-like protein 3(MPZL3) Protein (Q6UWV2) (32-235aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length of Mature Protein (32-235) |
| Form : | Lyophilized powder |
| AA Sequence : | LEIRADAHVRGYVGEKIKLKCTFKSTSDVTDKLTIDWTYRPPSSSHTVSIFHYQSFQYPT TAGTFRDRISWVGNVYKGDASISISNPTIKDNGTFSCAVKNPPDVHHNIPMTELTVTERG FGTMLSSVALLSILVFVPSAVVVALLLVRMGRKAAGLKKRSRSGYKKSSIEVSDDTDQEE EEACMARLCVRCAECLDSDYEETY |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | MPZL3 |
| Synonyms | MPZL3; UNQ2966/PRO7425; Myelin protein zero-like protein 3 |
| UniProt ID | Q6UWV2 |
| ◆ Recombinant Proteins | ||
| MPZL3-5660M | Recombinant Mouse MPZL3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| RFL34765BF | Recombinant Full Length Bovine Myelin Protein Zero-Like Protein 3(Mpzl3) Protein, His-Tagged | +Inquiry |
| MPZL3-481H | Recombinant Human MPZL3 Protein, His-tagged | +Inquiry |
| MPZL3-4567C | Recombinant Chicken MPZL3 | +Inquiry |
| RFL11623HF | Recombinant Full Length Human Myelin Protein Zero-Like Protein 3(Mpzl3) Protein, His-Tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MPZL3-4216HCL | Recombinant Human MPZL3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MPZL3 Products
Required fields are marked with *
My Review for All MPZL3 Products
Required fields are marked with *
