Recombinant Full Length Human MYEOV Protein, GST-tagged

• Cat.No.: MYEOV-6733HF
• Product Overview: Human MYEOV full-length ORF ( AAH11815.1, 1 a.a. - 313 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 313 amino acids
• Description: MYEOV (Myeloma Overexpressed) is a Protein Coding gene. Diseases associated with MYEOV include Multiple Myeloma and Deafness, Autosomal Recessive 63.
• Molecular Mass: 59.9 kDa
• AA Sequence: MALRICVTYTPALPIGLCTRCCLCLEQSPSWCHCLRGVSFLTFHLHQSVPLGDRDSLLMFTRQAGHFVEGSKAGRSRGRLCLSQALRVAVRGAFVSLWFAAGAGDRERNKGDKGAQTGAGLSQEAEDVDVSRARRVTDAPQGTLCGTGNRNSGSQSARAVGVAHLGEAFRVGVEQAISSCPEEVHGRHGLSMEIMWARMDVALRSPGRGLLAGAGALCVTLAESSCPDYERGRRACLTLHRHPTPHCSTWGLPLRVAGSWLTVVTVEALGGWRMGVRRTGQVGPTMHPPPVSGASPLLLHHLLLLLLIIILTC
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MYEOV myeloma overexpressed (in a subset of t(11;14) positive multiple myelomas) [ Homo sapiens ]
• Official Symbol: MYEOV
• Synonyms: OCIM; MYEOV; myeloma overexpressed (in a subset of t(11;14) positive multiple myelomas)
• Gene ID: 26579
• mRNA Refseq: NM_138768
• Protein Refseq: NP_620123
• MIM: 605625
• UniProt ID: Q96EZ4