Recombinant Full Length Human MYL10 Protein, GST-tagged
| Cat.No. : | MYL10-6766HF |
| Product Overview : | Human MYLC2PL full-length ORF ( NP_612412.2, 1 a.a. - 226 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 226 amino acids |
| Description : | MYL10 (Myosin Light Chain 10) is a Protein Coding gene. Among its related pathways are Focal Adhesion and Blood-Brain Barrier and Immune Cell Transmigration: VCAM-1/CD106 Signaling Pathways. GO annotations related to this gene include calcium ion binding. An important paralog of this gene is MYL2. |
| Molecular Mass : | 51.7 kDa |
| AA Sequence : | MLLRLVSNSWPQVILPPRPPKVLGLQAPRRARKRAEGTASSNVFSMFDQSQIQEFKESLALSPRLERNGMISAHCNLCLTGSSNSPASASQAFTIMDQNRDGFIDKEDLRDTFAALGRINVKNEELEAMVKEAPGPINFTVFLTMFGEKLKGTDPEETILHAFKVFDTEGKGFVKADVIKEKLMTQADRFSEEEVKQMFAAFPPDVCGNLDYRNLCYVITHGEEKD |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | MYL10 myosin light chain 10 [ Homo sapiens (human) ] |
| Official Symbol | MYL10 |
| Synonyms | MYL10; myosin light chain 10; PLRLC; MYLC2PL; myosin regulatory light chain 10; myosin light chain 2, lymphocyte-specific; myosin light chain 2, precursor lymphocyte-specific; myosin, light chain 10, regulatory; precursor lymphocyte-specific regulatory light chain |
| Gene ID | 93408 |
| mRNA Refseq | NM_138403 |
| Protein Refseq | NP_612412 |
| MIM | 617177 |
| UniProt ID | Q9BUA6 |
| ◆ Recombinant Proteins | ||
| MYL10-1133H | Recombinant Human MYL10, GST-tagged | +Inquiry |
| MYL10-3688C | Recombinant Chicken MYL10 | +Inquiry |
| MYL10-5818H | Recombinant Human MYL10 Protein, GST-tagged | +Inquiry |
| MYL10-2592Z | Recombinant Zebrafish MYL10 | +Inquiry |
| MYL10-10311M | Recombinant Mouse MYL10 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MYL10-1158HCL | Recombinant Human MYL10 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MYL10 Products
Required fields are marked with *
My Review for All MYL10 Products
Required fields are marked with *



