Recombinant Full Length Human MYL10 Protein, GST-tagged

Cat.No. : MYL10-6766HF
Product Overview : Human MYLC2PL full-length ORF ( NP_612412.2, 1 a.a. - 226 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 226 amino acids
Description : MYL10 (Myosin Light Chain 10) is a Protein Coding gene. Among its related pathways are Focal Adhesion and Blood-Brain Barrier and Immune Cell Transmigration: VCAM-1/CD106 Signaling Pathways. GO annotations related to this gene include calcium ion binding. An important paralog of this gene is MYL2.
Molecular Mass : 51.7 kDa
AA Sequence : MLLRLVSNSWPQVILPPRPPKVLGLQAPRRARKRAEGTASSNVFSMFDQSQIQEFKESLALSPRLERNGMISAHCNLCLTGSSNSPASASQAFTIMDQNRDGFIDKEDLRDTFAALGRINVKNEELEAMVKEAPGPINFTVFLTMFGEKLKGTDPEETILHAFKVFDTEGKGFVKADVIKEKLMTQADRFSEEEVKQMFAAFPPDVCGNLDYRNLCYVITHGEEKD
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MYL10 myosin light chain 10 [ Homo sapiens (human) ]
Official Symbol MYL10
Synonyms MYL10; myosin light chain 10; PLRLC; MYLC2PL; myosin regulatory light chain 10; myosin light chain 2, lymphocyte-specific; myosin light chain 2, precursor lymphocyte-specific; myosin, light chain 10, regulatory; precursor lymphocyte-specific regulatory light chain
Gene ID 93408
mRNA Refseq NM_138403
Protein Refseq NP_612412
MIM 617177
UniProt ID Q9BUA6

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MYL10 Products

Required fields are marked with *

My Review for All MYL10 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon