Recombinant Full Length Human MYL10 Protein, GST-tagged

• Cat.No.: MYL10-6766HF
• Product Overview: Human MYLC2PL full-length ORF ( NP_612412.2, 1 a.a. - 226 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 226 amino acids
• Description: MYL10 (Myosin Light Chain 10) is a Protein Coding gene. Among its related pathways are Focal Adhesion and Blood-Brain Barrier and Immune Cell Transmigration: VCAM-1/CD106 Signaling Pathways. GO annotations related to this gene include calcium ion binding. An important paralog of this gene is MYL2.
• Molecular Mass: 51.7 kDa
• AA Sequence: MLLRLVSNSWPQVILPPRPPKVLGLQAPRRARKRAEGTASSNVFSMFDQSQIQEFKESLALSPRLERNGMISAHCNLCLTGSSNSPASASQAFTIMDQNRDGFIDKEDLRDTFAALGRINVKNEELEAMVKEAPGPINFTVFLTMFGEKLKGTDPEETILHAFKVFDTEGKGFVKADVIKEKLMTQADRFSEEEVKQMFAAFPPDVCGNLDYRNLCYVITHGEEKD
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MYL10 myosin light chain 10 [ Homo sapiens (human) ]
• Official Symbol: MYL10
• Synonyms: MYL10; myosin light chain 10; PLRLC; MYLC2PL; myosin regulatory light chain 10; myosin light chain 2, lymphocyte-specific; myosin light chain 2, precursor lymphocyte-specific; myosin, light chain 10, regulatory; precursor lymphocyte-specific regulatory light chain
• Gene ID: 93408
• mRNA Refseq: NM_138403
• Protein Refseq: NP_612412
• MIM: 617177
• UniProt ID: Q9BUA6