Recombinant Human MYL10 Protein, GST-tagged
Cat.No. : | MYL10-5818H |
Product Overview : | Human MYLC2PL full-length ORF ( NP_612412.2, 1 a.a. - 226 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | MYL10 (Myosin Light Chain 10) is a Protein Coding gene. Among its related pathways are Focal Adhesion and Blood-Brain Barrier and Immune Cell Transmigration: VCAM-1/CD106 Signaling Pathways. GO annotations related to this gene include calcium ion binding. An important paralog of this gene is MYL2. |
Molecular Mass : | 51.7 kDa |
AA Sequence : | MLLRLVSNSWPQVILPPRPPKVLGLQAPRRARKRAEGTASSNVFSMFDQSQIQEFKESLALSPRLERNGMISAHCNLCLTGSSNSPASASQAFTIMDQNRDGFIDKEDLRDTFAALGRINVKNEELEAMVKEAPGPINFTVFLTMFGEKLKGTDPEETILHAFKVFDTEGKGFVKADVIKEKLMTQADRFSEEEVKQMFAAFPPDVCGNLDYRNLCYVITHGEEKD |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MYL10 myosin light chain 10 [ Homo sapiens (human) ] |
Official Symbol | MYL10 |
Synonyms | MYL10; myosin light chain 10; PLRLC; MYLC2PL; myosin regulatory light chain 10; myosin light chain 2, lymphocyte-specific; myosin light chain 2, precursor lymphocyte-specific; myosin, light chain 10, regulatory; precursor lymphocyte-specific regulatory light chain |
Gene ID | 93408 |
mRNA Refseq | NM_138403 |
Protein Refseq | NP_612412 |
MIM | 617177 |
UniProt ID | Q9BUA6 |
◆ Recombinant Proteins | ||
MYL10-3688C | Recombinant Chicken MYL10 | +Inquiry |
MYL10-1133H | Recombinant Human MYL10, GST-tagged | +Inquiry |
MYL10-10311M | Recombinant Mouse MYL10 Protein | +Inquiry |
MYL10-5818H | Recombinant Human MYL10 Protein, GST-tagged | +Inquiry |
MYL10-2592Z | Recombinant Zebrafish MYL10 | +Inquiry |
◆ Cell & Tissue Lysates | ||
MYL10-1158HCL | Recombinant Human MYL10 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MYL10 Products
Required fields are marked with *
My Review for All MYL10 Products
Required fields are marked with *
0
Inquiry Basket