| Species : | Human | 
                                
                                    | Source : | Mammalian Cells | 
                                
                                    | Tag : | Flag | 
                                
                                    | Description : | MYL3 encodes myosin light chain 3, an alkali light chain also referred to in the literature as both the ventricular isoform and the slow skeletal muscle isoform. Mutations in MYL3 have been identified as a cause of mid-left ventricular chamber type hypertrophic cardiomyopathy. | 
                                
                                    | Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. | 
                                
                                    | Molecular Mass : | 21.8 kDa | 
                                
                                    | AA Sequence : | MAPKKPEPKKDDAKAAPKAAPAPAPPPEPERPKEVEFDASKIKIEFTPEQIEEFKEAFMLFDRTPKCEMK ITYGQCGDVLRALGQNPTQAEVLRVLGKPRQEELNTKMMDFETFLPMLQHISKNKDTGTYEDFVEGLRVF DKEGNGTVMGAELRHVLATLGERLTEDEVEKLMAGQEDSNGCINYEAFVKHIMSSTRTRPLEQKLISEEDLAANDILDYKDDDDKV
 | 
                                
                                    | Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. | 
                                
                                    | Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. | 
                                
                                    | Storage : | Store at -80 centigrade. | 
                                
                                    | Concentration : | >50 ug/mL as determined by microplate BCA method. | 
                                
                                    | Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. | 
                                
                                    | Protein Families : | Druggable Genome | 
                                
                                    | Protein Pathways : | Cardiac muscle contraction, Dilated cardiomyopathy, Hypertrophic cardiomyopathy (HCM) | 
                                
                                    | Full Length : | Full L. |