Recombinant Full Length Human MYL4 Protein
| Cat.No. : | MYL4-323HF |
| Product Overview : | Recombinant full length Human MYL4 with an N terminal proprietary tag; Predicted MWt 47.41 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Protein Length : | 197 amino acids |
| Description : | Myosin is a hexameric ATPase cellular motor protein. It is composed of two myosin heavy chains, two nonphosphorylatable myosin alkali light chains, and two phosphorylatable myosin regulatory light chains. This gene encodes a myosin alkali light chain that is found in embryonic muscle and adult atria. Two alternatively spliced transcript variants encoding the same protein have been found for this gene. |
| Form : | Liquid |
| Molecular Mass : | 47.410kDa inclusive of tags |
| AA Sequence : | MAPKKPEPKKEAAKPAPAPAPAPAPAPAPAPEAPKEPAFD PKSVKIDFTADQIEEFKEAFSLFDRTPTGEMKITYGQCGD VLRALGQNPTNAEVLRVLGKPKPEEMNVKMLDFETFLPIL QHISRNKEQGTYEDFVEGLRVFDKESNGTVMGAELRHVLA TLGEKMTEAEVEQLLAGQEDANGCINYEAFVKHIMSG |
| Purity : | Proprietary Purification |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
| Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
| Gene Name | MYL4 myosin, light chain 4, alkali; atrial, embryonic [ Homo sapiens ] |
| Official Symbol | MYL4 |
| Synonyms | MYL4; myosin, light chain 4, alkali; atrial, embryonic; myosin, light polypeptide 4, alkali; atrial, embryonic; myosin light chain 4; ALC1; AMLC; GT1; myosin; atrial/fetal muscle; light chain; PRO1957 |
| Gene ID | 4635 |
| mRNA Refseq | NM_001002841 |
| Protein Refseq | NP_001002841 |
| MIM | 160770 |
| UniProt ID | P12829 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MYL4 Products
Required fields are marked with *
My Review for All MYL4 Products
Required fields are marked with *


