Recombinant Full Length Human MYL7 Protein, GST-tagged

• Cat.No.: MYL7-6764HF
• Product Overview: Human MYL7 full-length ORF (BAG34810.1, 1 a.a. - 175 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 175 amino acids
• Description: MYL7 (Myosin Light Chain 7) is a Protein Coding gene. Diseases associated with MYL7 include Fechtner Syndrome and Familial Atrial Fibrillation. Among its related pathways are Focal Adhesion and Sertoli-Sertoli Cell Junction Dynamics. GO annotations related to this gene include calcium ion binding. An important paralog of this gene is MYL5.
• Molecular Mass: 45.65 kDa
• AA Sequence: MASRKAGTRGKVAATKQAQRGSSNVFSMFEQAQIQEFKEAFSCIDQNRDGIICKADLRETYSQLGKVSVPEEELDAMLQEGKGPINFTVFLTLFGEKLNGTDPEEAILSAFRMFDPSGKGVVNKDEFKQLLLTQADKFSPAEVEQMFALTPMDLAGNIDYKSLCYIITHGDEKEE
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MYL7 myosin light chain 7 [ Homo sapiens (human) ]
• Official Symbol: MYL7
• Synonyms: MYL7; myosin, light chain 7, regulatory; myosin, light polypeptide 7, regulatory; myosin regulatory light chain 2, atrial isoform; MYL2A; MYLC2A; MLC2a; MLC-2a; myosin light chain 2a; myosin regulatory light chain 7
• Gene ID: 58498
• mRNA Refseq: NM_021223
• Protein Refseq: NP_067046
• MIM: 613993
• UniProt ID: Q01449