Recombinant Full Length Human MYL7 Protein, GST-tagged
Cat.No. : | MYL7-6764HF |
Product Overview : | Human MYL7 full-length ORF (BAG34810.1, 1 a.a. - 175 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 175 amino acids |
Description : | MYL7 (Myosin Light Chain 7) is a Protein Coding gene. Diseases associated with MYL7 include Fechtner Syndrome and Familial Atrial Fibrillation. Among its related pathways are Focal Adhesion and Sertoli-Sertoli Cell Junction Dynamics. GO annotations related to this gene include calcium ion binding. An important paralog of this gene is MYL5. |
Molecular Mass : | 45.65 kDa |
AA Sequence : | MASRKAGTRGKVAATKQAQRGSSNVFSMFEQAQIQEFKEAFSCIDQNRDGIICKADLRETYSQLGKVSVPEEELDAMLQEGKGPINFTVFLTLFGEKLNGTDPEEAILSAFRMFDPSGKGVVNKDEFKQLLLTQADKFSPAEVEQMFALTPMDLAGNIDYKSLCYIITHGDEKEE |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MYL7 myosin light chain 7 [ Homo sapiens (human) ] |
Official Symbol | MYL7 |
Synonyms | MYL7; myosin, light chain 7, regulatory; myosin, light polypeptide 7, regulatory; myosin regulatory light chain 2, atrial isoform; MYL2A; MYLC2A; MLC2a; MLC-2a; myosin light chain 2a; myosin regulatory light chain 7; |
Gene ID | 58498 |
mRNA Refseq | NM_021223 |
Protein Refseq | NP_067046 |
MIM | 613993 |
UniProt ID | Q01449 |
◆ Recombinant Proteins | ||
MYL7-8916Z | Recombinant Zebrafish MYL7 | +Inquiry |
MYL7-4931H | Recombinant Human MYL7 protein, GST-tagged | +Inquiry |
MYL7-6764HF | Recombinant Full Length Human MYL7 Protein, GST-tagged | +Inquiry |
MYL7-3699H | Recombinant Human MYL7 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Myl7-4255M | Recombinant Mouse Myl7 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MYL7-4021HCL | Recombinant Human MYL7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MYL7 Products
Required fields are marked with *
My Review for All MYL7 Products
Required fields are marked with *
0
Inquiry Basket