Recombinant Full Length Human MZT2B Protein, GST-tagged
Cat.No. : | MZT2B-4567HF |
Product Overview : | Human FAM128B full-length ORF ( NP_079305.2, 1 a.a. - 158 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 158 amino acids |
Description : | MZT2B (Mitotic Spindle Organizing Protein 2B) is a Protein Coding gene. An important paralog of this gene is MZT2A. |
Molecular Mass : | 42.6 kDa |
AA Sequence : | MAAQGVGPGPGSAAPPGLEAARQKLALRRKKVLSTEEMELYELAQAAGGAIDPDVFKILVDLLKLNVAPLAVFQMLKSMCAGQRLASEPQDPAAVSLPTSSVPETRGRNKGSAALGGALALAERSSREGSSQRMPRQPSATRLPKGGGPGKSPTRGST |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MZT2B mitotic spindle organizing protein 2B [ Homo sapiens (human) ] |
Official Symbol | MZT2B |
Synonyms | MZT2B; mitotic spindle organizing protein 2B; Mitotic Spindle Organizing Protein 2B; Mitotic-Spindle Organizing Protein Associated With A Ring Of Gamma-Tubulin 2B; Family With Sequence Similarity 128, Member B; MOZART2B; FAM128B; Mitotic-Spindle Organizing Protein 2B; mitotic-spindle organizing protein 2B; family with sequence similarity 128, member B; mitotic-spindle organizing protein associated with a ring of gamma-tubulin 2B |
Gene ID | 80097 |
mRNA Refseq | NM_001330282 |
Protein Refseq | NP_001317211 |
MIM | 613450 |
UniProt ID | Q6NZ67 |
◆ Recombinant Proteins | ||
MZT2B-2931R | Recombinant Rhesus monkey MZT2B Protein, His-tagged | +Inquiry |
MZT2B-2751R | Recombinant Rhesus Macaque MZT2B Protein, His (Fc)-Avi-tagged | +Inquiry |
MZT2B-2421H | Recombinant Human MZT2B Protein, MYC/DDK-tagged | +Inquiry |
MZT2B-4567HF | Recombinant Full Length Human MZT2B Protein, GST-tagged | +Inquiry |
MZT2B-3699H | Recombinant Human MZT2B Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MZT2B Products
Required fields are marked with *
My Review for All MZT2B Products
Required fields are marked with *
0
Inquiry Basket